Property Summary

NCBI Gene PubMed Count 30
Grant Count 46
R01 Count 9
Funding $11,802,913.92
PubMed Score 111.01
PubTator Score 53.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic cancer 1.100 0.002
malignant mesothelioma 1.600 0.000
osteosarcoma -1.116 0.001
pancreatic carcinoma 1.100 0.002

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (21)

PMID Text
26685208 results suggest that appropriate regulation of ARID3a is critical for normal development of both myeloid and B lineage pathways.
25535283 These data reveal new functions for ARID3a in early hematopoiesis and suggest that knowledge regarding ARID3a levels in HSPCs could be informative for applications requiring transplantation of those cells.
25185498 Systemic lupus erythematosus (SLE) patients had increased ARID3a+ B cells compared to healthy controls. ARID3a was not expressed in naive B cells of controls, but was abundant in SLE patients. Number of ARID3a+ B cells correlated with disease activity.
22469780 miR-125b can act as an oncogene in B-cell acute lymphoblastic leukemia by targeting ARID3a and mediating its repression.
22302879 These findings support the hypothesis that Epstein-Barr virus EBNA1 initiates transcription at the C promoter via interactions between multiple EBNA1 homodimers and cellular transcription such as E2F1, ARID3A and Oct-2.
22172947 These results indicate both cooperative and interdependent roles for ARID3A and p53 in the transcriptional activation of p21(WAF1) in response to DNA damage.
22010578 functions as a critical antagonist to the p16(INK4A)-Rb tumor suppressor machinery by regulating promyelocytic leukemia protein stability
21248039 report that E2FBP1 inhibits accumulation of ICP0 RNA and, at the same time, is degraded via ICP0's herpes ubiquitin ligase 2 (HUL-2) activity upon HSV-1 infection.
20680960 Bright/ARID3a inhibition causes increased developmental plasticity in mouse and human cells.
20455271 Solution NMR structure of the ARID domain of human ARID3A.
More...

AA Sequence

MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPESARMQRAQMAALAAMRAAAA      1 - 70
GLGHPASPGGSEDGPPGSEEEDAAREGTPGSPGRGREGPGEEHFEDMASDEDMKPKWEEEEMEEDLGEDE     71 - 140
EEEEEDYEDEEEEEDEEGLGPPGPASLGTTALFPRKAQPPQAFRGDGVPRVLGGQERPGPGPAHPGGAAH    141 - 210
VAPQLQPPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVT    211 - 280
EKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGR    281 - 350
RQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGH    351 - 420
PVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLP    421 - 490
MSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGGSSSN    491 - 560
AGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP                                         561 - 593
//

Publication (42)

PMID Year Title
26685208 2016 The Transcription Factor ARID3a Is Important for In Vitro Differentiation of Human Hematopoietic Progenitors.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25535283 2015 Differential expression of the transcription factor ARID3a in lupus patient hematopoietic progenitor cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25185498 2014 Disease activity in systemic lupus erythematosus correlates with expression of the transcription factor AT-rich-interactive domain 3A.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22469780 2012 B-cell regulator of immunoglobulin heavy-chain transcription (Bright)/ARID3a is a direct target of the oncomir microRNA-125b in progenitor B-cells.
22302879 2012 E2F1, ARID3A/Bright and Oct-2 factors bind to the Epstein-Barr virus C promoter, EBNA1 and oriP, participating in long-distance promoter-enhancer interactions.
More...