Property Summary

NCBI Gene PubMed Count 31
PubMed Score 136.45
PubTator Score 53.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
malignant mesothelioma 3232 2.2e-05
osteosarcoma 7950 9.9e-04
pancreatic carcinoma 562 2.0e-03
pancreatic cancer 2398 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Glaucoma 239 0.0 2.2
Disease Target Count Z-score Confidence
Chronic recurrent multifocal osteomyelitis 6 3.38 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.600 2.2e-05
osteosarcoma -1.116 9.9e-04
pancreatic cancer 1.100 2.0e-03
pancreatic carcinoma 1.100 2.0e-03

Protein-protein Interaction (3)

Gene RIF (22)

AA Sequence

MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPESARMQRAQMAALAAMRAAAA      1 - 70
GLGHPASPGGSEDGPPGSEEEDAAREGTPGSPGRGREGPGEEHFEDMASDEDMKPKWEEEEMEEDLGEDE     71 - 140
EEEEEDYEDEEEEEDEEGLGPPGPASLGTTALFPRKAQPPQAFRGDGVPRVLGGQERPGPGPAHPGGAAH    141 - 210
VAPQLQPPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVT    211 - 280
EKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGR    281 - 350
RQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGH    351 - 420
PVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLP    421 - 490
MSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGGSSSN    491 - 560
AGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP                                         561 - 593
//

Text Mined References (44)

PMID Year Title