Property Summary

NCBI Gene PubMed Count 3
PubMed Score 14.61
PubTator Score 3.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Multiple Sclerosis 498 0.0032341443698343
Disease Target Count Z-score Confidence
Wernicke-Korsakoff syndrome 8 3.988 2.0

Synonym

Accession Q99853 O60652 O75917 Q14CL2
Symbols FKH5
HFKH-5

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

AA Sequence

MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDC      1 - 70
FIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKLRLSAL     71 - 140
AASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSS    141 - 210
LGTGWPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPI    211 - 280
PTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH                             281 - 325
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.