Property Summary

NCBI Gene PubMed Count 3
PubMed Score 15.72
PubTator Score 3.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple Sclerosis 540 3.2e-03
Disease Target Count Z-score Confidence
Wernicke-Korsakoff syndrome 10 3.974 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.900 3.2e-03

AA Sequence

MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDC      1 - 70
FIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKLRLSAL     71 - 140
AASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSS    141 - 210
LGTGWPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPI    211 - 280
PTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH                             281 - 325
//

Text Mined References (5)

PMID Year Title