Property Summary

NCBI Gene PubMed Count 24
PubMed Score 34.87
PubTator Score 23.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.0e-05
lung cancer 4740 1.3e-04
dermatomyositis 966 1.9e-04
diabetes mellitus 1728 1.6e-03
colon cancer 1478 5.3e-03
Breast cancer 3578 2.7e-02
astrocytic glioma 2597 3.3e-02
oligodendroglioma 2850 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Intracranial hypotension 10 4.225 2.1
Bruxism 18 3.612 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.600 3.3e-02
Breast cancer 2.300 2.7e-02
colon cancer 1.200 5.3e-03
dermatomyositis 1.200 1.9e-04
diabetes mellitus -1.400 1.6e-03
lung cancer 1.400 1.3e-04
oligodendroglioma -1.500 4.1e-02
ovarian cancer 2.500 1.0e-05

 GO Function (1)

Gene RIF (7)

AA Sequence

MDTPPLSDSESESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERL      1 - 70
DVTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLPRLHQLKVPTKRPTDYFAEM     71 - 140
AKSDLQMQKIRQKLQTKQAAMERSEKAKQLRALRKYGKKVQTEVLQKRQQEKAHMMNAIKKYQKGFSDKL    141 - 210
DFLEGDQKPLAQRKKAGAKGQQMRKGPSAKRRYKNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTAHGRG    211 - 280
LKRPGKKGSNKRPGKRTREKMKNRTH                                                281 - 306
//

Text Mined References (33)

PMID Year Title