Property Summary

NCBI Gene PubMed Count 23
Grant Count 62
R01 Count 53
Funding $6,971,646.63
PubMed Score 32.23
PubTator Score 23.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.600 0.033
oligodendroglioma -1.500 0.041
colon cancer 1.200 0.005
lung cancer 1.400 0.000
diabetes mellitus -1.400 0.002
Breast cancer 2.300 0.027
ovarian cancer 2.500 0.000
dermatomyositis 1.200 0.000

Synonym

Accession Q99848 Q96A66
Symbols P40
EBP2
NOBP

Gene

 GO Function (1)

Gene RIF (7)

PMID Text
25501510 We further show that the primary tumors as well as metastasized lesions derived from EBV antigen-expressing cancer cells( EBNA3C or EBNA1 ) in nude mice model display EMT markers expression pattern
24481446 EBP2 is a novel binding partner of c-Myc that regulates cell proliferation, and tumorigenesis via a positive feedback loop.
22944692 Positional proteomics analysis identifies the cleavage of human EBNA1 binding protein 2 (EBNA1BP2) at amino acid residues 212-213 by the HIV-1 protease
19170763 BXDC1 and EBNA1BP2 function in a dynamic scaffold for ribosome biogenesis.
18959818 RNA and protein levels of cyclin E1, a dominant oncoprotein, were elevated in the EBP2- enhanced green fluorescent protein stable clones.
15923612 Data show that human EBNA1 binding protein 2 (hEBP2 is essential for the proliferation of human cells and that repression of hEBP2 severely decreases the ability of EBNA1 and EBV-based plasmids to bind mitotic chromosomes.
12768013 attaches to yeast mitotic chromosomes in a cell cycle-dependent manner and causes EBNA1 to attach to the mitotic chromosomes and effect EBV plasmid segregation

AA Sequence

MDTPPLSDSESESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERL      1 - 70
DVTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLPRLHQLKVPTKRPTDYFAEM     71 - 140
AKSDLQMQKIRQKLQTKQAAMERSEKAKQLRALRKYGKKVQTEVLQKRQQEKAHMMNAIKKYQKGFSDKL    141 - 210
DFLEGDQKPLAQRKKAGAKGQQMRKGPSAKRRYKNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTAHGRG    211 - 280
LKRPGKKGSNKRPGKRTREKMKNRTH                                                281 - 306
//

Text Mined References (31)

PMID Year Title
25501510 2015 Epstein-Barr virus latent antigens EBNA3C and EBNA1 modulate epithelial to mesenchymal transition of cancer cells associated with tumor metastasis.
24481446 2014 A positive feedback loop between EBP2 and c-Myc regulates rDNA transcription, cell proliferation, and tumorigenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23848194 2013 Nucleolar scaffold protein, WDR46, determines the granular compartmental localization of nucleolin and DDX21.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...