Property Summary

NCBI Gene PubMed Count 326
Grant Count 1,222
R01 Count 756
Funding $114,051,676.78
PubMed Score 1606.05
PubTator Score 663.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
cutaneous lupus erythematosus 1.300 0.000
psoriasis 1.800 0.000
glioblastoma 2.200 0.000
astrocytoma 1.600 0.016
primitive neuroectodermal tumor 1.300 0.004
juvenile dermatomyositis 1.334 0.000
intraductal papillary-mucinous neoplasm ... 2.000 0.001
lung cancer -2.200 0.000
Multiple Sclerosis 1.200 0.000
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.600 0.000
subependymal giant cell astrocytoma 1.538 0.020
lung carcinoma -1.200 0.000
ovarian cancer 1.800 0.000

Synonym

Gene

PDB

3MOP   2JS7   2Z5V   4DOM   4EO7  

Gene RIF (274)

PMID Text
27079437 these results suggest that targeting the COX-2/PGE2 pathway together with TLR/MyD88 signaling, which would suppress the inflammatory microenvironment and maintenance of stemness, could be an effective preventive or therapeutic strategy for gastric cancer
26900675 MYD88 gene analysis is a helpful ancillary tool for diagnosing vitreoretinal lymphoma (VRL)
26752547 MYD88 L265P and CD79B mutations were frequently detected in primary breast diffuse large B-cell lymphoma.
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26719415 Deubiquitinase CYLD negatively regulates MyD88-mediated signaling by directly interacting with MyD88 and deubiquitinating nontypeable Haemophilus influenzae (NTHi)-induced K63-linked polyubiquitination of MyD88 at lysine 231.
26711529 These results indicate that the LPS/IL-1beta-MyD88 axis plays a crucial role for stabilization of IkappaB-zeta mRNA.
26669856 MyD88s is positively regulated by IKKbeta and CREB and negatively regulated by ERK1/2 signaling pathways.
26600481 MyD88 was expressed at a higher level in NSCLC tissues and was closely associated with poor prognosis.
26592460 Data show that sterile alpha- and armadillo-motif-containing protein (SARM) modulates MyD88 protein-mediated Toll-like receptors (TLRs) activation through BB-loop dependent interleukin-1 receptor (TIR) TIR-TIR interactions.
26563875 Knockdown of MyD88 significantly inhibited matrix metalloproteinase expression in chondrocytes.
More...

AA Sequence

MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADP      1 - 70
TGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPR     71 - 140
TAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASE    141 - 210
LIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPC    211 - 280
TKSWFWTRLAKALSLP                                                          281 - 296
//

Text Mined References (332)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27079437 2016 Inflammation in gastric cancer: Interplay of the COX-2/prostaglandin E2 and Toll-like receptor/MyD88 pathways.
26900675 2016 PREVALENCE OF MYD88 L265P MUTATION IN HISTOLOGICALLY PROVEN, DIFFUSE LARGE B-CELL VITREORETINAL LYMPHOMA.
26752547 2016 Frequent MYD88 L265P and CD79B Mutations in Primary Breast Diffuse Large B-Cell Lymphoma.
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26719415 2016 Deubiquitinase CYLD acts as a negative regulator for bacterium NTHi-induced inflammation by suppressing K63-linked ubiquitination of MyD88.
26711529 2016 Screening of posttranscriptional regulatory molecules of I?B-?.
26669856 2015 Nontypeable Haemophilus influenzae-Induced MyD88 Short Expression Is Regulated by Positive IKK? and CREB Pathways and Negative ERK1/2 Pathway.
26600481 2015 Expression and significance of myeloid differentiation factor 88 in non-small cell lung carcinoma and normal paracancerous tissues.
26592460 2016 SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions.
More...