Property Summary

NCBI Gene PubMed Count 369
PubMed Score 1795.44
PubTator Score 663.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Immune system cancer 140 0.0 2.5
Lymphoid leukemia 160 0.0 2.5
Disease Target Count
Diffuse large B-cell lymphoma 39
WM1 1

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.500 8.0e-04
astrocytoma 1.600 1.6e-02
Astrocytoma, Pilocytic 1.600 4.0e-07
cutaneous lupus erythematosus 1.300 2.7e-04
glioblastoma 1.700 1.3e-09
intraductal papillary-mucinous neoplasm ... 2.000 6.9e-04
juvenile dermatomyositis 1.334 1.6e-12
lung cancer -2.200 4.2e-05
lung carcinoma -1.200 1.4e-16
malignant mesothelioma -2.100 7.2e-08
Multiple Sclerosis 1.200 4.0e-04
ovarian cancer 1.800 6.0e-06
primitive neuroectodermal tumor 1.300 4.0e-03
psoriasis 1.800 5.8e-05
subependymal giant cell astrocytoma 1.538 2.0e-02

Protein-protein Interaction (1)

Gene RIF (313)

AA Sequence

MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADP      1 - 70
TGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPR     71 - 140
TAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASE    141 - 210
LIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPC    211 - 280
TKSWFWTRLAKALSLP                                                          281 - 296
//

Text Mined References (375)

PMID Year Title