Property Summary

Ligand Count 236
NCBI Gene PubMed Count 111
PubMed Score 14.45
PubTator Score 331.28

Knowledge Summary

Patent (70,141)

TINX Plot

  Disease (7)

Disease Target Count
Basal cell carcinoma of skin 2
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Nevoid basal cell carcinoma syndrome 16 3.141 1.6
Disease Target Count
BCC1 3
Curry-Jones syndrome 1

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.900 4.3e-10
cutaneous lupus erythematosus -1.200 6.9e-03
ependymoma 1.100 8.8e-03
glioblastoma 1.300 2.4e-06
lung cancer 1.200 9.7e-03
medulloblastoma 1.300 3.5e-05
medulloblastoma, large-cell 1.100 6.0e-03
osteosarcoma 1.529 7.7e-05

Gene RIF (88)

AA Sequence

MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPC      1 - 70
EPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVE     71 - 140
LPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDV    141 - 210
EGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIG    211 - 280
WLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTY    281 - 350
QPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI    351 - 420
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLC    421 - 490
QANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEP    491 - 560
KRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRG    561 - 630
AILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPST    631 - 700
IPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIH    701 - 770
SRTNLMDTELMDADSDF                                                         771 - 787
//

Text Mined References (112)

PMID Year Title