Property Summary

NCBI Gene PubMed Count 97
Grant Count 372
R01 Count 238
Funding $30,926,850.32
PubMed Score 12.47
PubTator Score 331.28

Knowledge Summary

Patent (70,141)

Expression

  Differential Expression (8)

Synonym

Accession Q99835 A4D1K5 SMO
Symbols Gx
CRJS
SMOH
FZD11

Gene

SMO

PDB

4JKV   4N4W   4O9R   4QIM   4QIN   5L7D   5L7I  

Gene RIF (74)

PMID Text
27437577 crystal structures of the Hh signal transducer and oncoprotein Smoothened, a GPCR that contains two distinct ligand-binding sites: one in its transmembrane domain and one in the cysteine-rich domain
27002170 Smoothened determines beta-arrestin-mediated removal of the G protein-coupled receptor Gpr161 from the primary cilium.
26655998 Suggest that hypoxia promotes SMO transcription through upregulation of MAML3 and RBPJ to induce proliferation, invasiveness and tumorigenesis in pancreatic cancer.
26317547 Crocetinic acid inhibited the expression of both Shh and smoothened in pancreatic cancer stem cells, thereby inhibiting pancreatic tumorigenesis
26261515 These findings suggest that miR-218 inhibits multidrug resistance of gastric cancer cells by down-regulating smoothened expression.
26130651 Strikingly, in basal cell carcinoma patients treated with Smo inhibitor, squamous cell cancers with RAS/MAPK activation emerged from the antecedent basal cell carcinoma tumors.
26126827 Calcitriol represents a possible endogenous transmitter of Ptch/Smo interaction.
26124204 The combined inhibition of SMO and EGFR exerted a strong antiproliferative activity.
25944162 Recipient SMO rs3824 polymorphism is associated with an increased risk of hepatocellular carcinoma recurrence following orthotopic liver transplantation.
25854168 The SMOF412E mutation was not detected in ameloblastoma. The BRAFV600E-activating mutation is a common event in ameloblastomas, occurring regardless of site or histological type. This mutation is also detected in odontogenic carcinomas.
More...

AA Sequence

MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPC      1 - 70
EPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVE     71 - 140
LPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDV    141 - 210
EGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIG    211 - 280
WLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTY    281 - 350
QPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI    351 - 420
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLC    421 - 490
QANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEP    491 - 560
KRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRG    561 - 630
AILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPST    631 - 700
IPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIH    701 - 770
SRTNLMDTELMDADSDF                                                         771 - 787
//

Text Mined References (98)

PMID Year Title
27437577 2016 Structural basis of Smoothened regulation by its extracellular domains.
27002170 2016 Smoothened determines ?-arrestin-mediated removal of the G protein-coupled receptor Gpr161 from the primary cilium.
26655998 2016 Hypoxia but not normoxia promotes Smoothened transcription through upregulation of RBPJ and Mastermind-like 3 in pancreatic cancer.
26317547 2015 Crocetinic acid inhibits hedgehog signaling to inhibit pancreatic cancer stem cells.
26261515 2015 MiR-218 inhibits multidrug resistance (MDR) of gastric cancer cells by targeting Hedgehog/smoothened.
26130651 2015 RAS/MAPK Activation Drives Resistance to Smo Inhibition, Metastasis, and Tumor Evolution in Shh Pathway-Dependent Tumors.
26126827 2015 A Functional and Putative Physiological Role of Calcitriol in Patched1/Smoothened Interaction.
26124204 2015 SMO Gene Amplification and Activation of the Hedgehog Pathway as Novel Mechanisms of Resistance to Anti-Epidermal Growth Factor Receptor Drugs in Human Lung Cancer.
25944162 2015 Association between donor and recipient smoothened gene polymorphisms and the risk of hepatocellular carcinoma recurrence following orthotopic liver transplantation in a Han Chinese population.
25854168 2015 Assessment of BRAFV600E and SMOF412E mutations in epithelial odontogenic tumours.
More...