Property Summary

NCBI Gene PubMed Count 23
PubMed Score 25.95
PubTator Score 6.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
HIV Infections 102 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
Multiple myeloma 1332 5.3e-04
ovarian cancer 8520 9.6e-04
lung cancer 4740 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Babesiosis 14 5.054 2.5
Alexithymia 16 3.601 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 2.0e-03
Multiple myeloma 1.492 5.3e-04
ovarian cancer 1.600 9.6e-04

Gene RIF (6)

AA Sequence

MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLD      1 - 70
VVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIA     71 - 140
VTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQL    141 - 210
VAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEK    211 - 280
IHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEE    281 - 350
TQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL    351 - 420
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEA    421 - 490
FVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRGRPH                     491 - 543
//

Text Mined References (33)

PMID Year Title