Property Summary

NCBI Gene PubMed Count 23
PubMed Score 25.88
PubTator Score 6.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.492 0.001
lung cancer 1.800 0.000
ovarian cancer 1.600 0.001

Synonym

Accession Q99832 A8K7E6 A8MWI8 B7WNW9 B7Z4T9 B7Z4Z7 O14871 Q6FI26 TCP-1-eta
Symbols CCTH
CCTETA
NIP7-1
TCP1ETA

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
23292503 the increased expression of CCT-eta appears to be a marker for latent and active Dupuytren's contracture and to be essential for the increased contractility exhibited by these fibroblasts
20877624 Observational study of gene-disease association. (HuGE Navigator)
15347653 A protein in mouse, that is highly similar to the one described in this record, was found to interact with a protein involved in the Nitric oxide (NO) signal transduction pathway, soluble guanylyl cyclase (sGC).
11532003 Functional characterization of the CCT complex and its subunits in mouse.

AA Sequence

MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLD      1 - 70
VVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIA     71 - 140
VTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQL    141 - 210
VAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEK    211 - 280
IHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEE    281 - 350
TQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL    351 - 420
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEA    421 - 490
FVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRGRPH                     491 - 543
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23292503 2013 Increased CCT-eta expression is a marker of latent and active disease and a modulator of fibroblast contractility in Dupuytren's contracture.
23011926 2013 Human TRiC complex purified from HeLa cells contains all eight CCT subunits and is active in vitro.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...