Property Summary

NCBI Gene PubMed Count 23
PubMed Score 25.88
PubTator Score 6.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung cancer 4473 1.90815823225045E-5
Multiple myeloma 1328 5.28724632719883E-4
ovarian cancer 8492 9.57706937250258E-4
Disease Target Count Z-score Confidence
Babesiosis 13 5.203 2.6
Alexithymia 14 3.733 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.492 0.001
lung cancer 1.800 0.000
ovarian cancer 1.600 0.001

Synonym

Accession Q99832 A8K7E6 A8MWI8 B7WNW9 B7Z4T9 B7Z4Z7 O14871 Q6FI26 TCP-1-eta
Symbols CCTH
CCTETA
NIP7-1
TCP1ETA

Gene

PANTHER Protein Class (2)

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (4)

PMID Text
23292503 the increased expression of CCT-eta appears to be a marker for latent and active Dupuytren's contracture and to be essential for the increased contractility exhibited by these fibroblasts
20877624 Observational study of gene-disease association. (HuGE Navigator)
15347653 A protein in mouse, that is highly similar to the one described in this record, was found to interact with a protein involved in the Nitric oxide (NO) signal transduction pathway, soluble guanylyl cyclase (sGC).
11532003 Functional characterization of the CCT complex and its subunits in mouse.

AA Sequence

MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLD      1 - 70
VVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIA     71 - 140
VTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQL    141 - 210
VAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEK    211 - 280
IHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEE    281 - 350
TQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL    351 - 420
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEA    421 - 490
FVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRGRPH                     491 - 543
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23292503 2013 Increased CCT-eta expression is a marker of latent and active disease and a modulator of fibroblast contractility in Dupuytren's contracture.
23011926 2013 Human TRiC complex purified from HeLa cells contains all eight CCT subunits and is active in vitro.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...