Property Summary

NCBI Gene PubMed Count 20
Grant Count 1
Funding $52,259.89
PubMed Score 5.50
PubTator Score 7.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.100 0.050
oligodendroglioma 1.300 0.007
ovarian cancer 1.300 0.000

Synonym

Accession Q99829 E1P5Q4 Q6IBL3 Q9H243 Q9NTZ7
Symbols CPN1
COPN1

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (3)

PMID Text
18831769 CPNE1 shares a promoter and 5'UTR exons with RBM12. This genomic structure is conserved among multiple species.
18523666 Copine1 is upregulated in plasma membranes of TM cells in individuals with primary open-angle glaucoma.
14674885 Copine I regulates tumour necrosis factor-alpha receptor signaling pathways.

AA Sequence

MAHCVTLVQLSISCDHLIDKDIGSKSDPLCVLLQDVGGGSWAELGRTERVRNCSSPEFSKTLQLEYRFET      1 - 70
VQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPGKPAGRGTITVSAQELKDNRVV     71 - 140
TMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV    141 - 210
QCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMG    211 - 280
GCQINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQ    281 - 350
VSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLL    351 - 420
TDGAVTDVEATREAVVRASNLPMSVIIVGVGGADFEAMEQLDADGGPLHTRSGQAAARDIVQFVPYRRFQ    421 - 490
NAPREALAQTVLAEVPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQA                           491 - 537
//

Text Mined References (23)

PMID Year Title
25450385 2014 Copine1 C2 domains have a critical calcium-independent role in the neuronal differentiation of hippocampal progenitor HiB5 cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23263657 2012 Copine1 enhances neuronal differentiation of the hippocampal progenitor HiB5 cells.
21269460 2011 Initial characterization of the human central proteome.
21087455 2010 Copines-1, -2, -3, -6 and -7 show different calcium-dependent intracellular membrane translocation and targeting.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19539605 2009 Organization and synergistic binding of copine I and annexin A1 on supported lipid bilayers observed by atomic force microscopy.
18831769 2008 Promoter-sharing by different genes in human genome--CPNE1 and RBM12 gene pair as an example.
18523666 2008 Upregulation of Copine1 in trabecular meshwork cells of POAG patients: a membrane proteomics approach.
More...