Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.54
PubTator Score 6.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -2.300 0.000
ependymoma -3.000 0.000
oligodendroglioma -1.900 0.000
glioblastoma -2.500 0.000
group 4 medulloblastoma -3.200 0.000
atypical teratoid/rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -1.600 0.002
primitive neuroectodermal tumor -1.800 0.005
adult high grade glioma -2.800 0.000
pilocytic astrocytoma -2.700 0.000
subependymal giant cell astrocytoma -2.123 0.037
gastric carcinoma -1.200 0.004
ovarian cancer -1.100 0.000
psoriasis -1.300 0.000

Gene RIF (2)

PMID Text
20098615 Observational study of gene-disease association. (HuGE Navigator)
15513926 analysis of inhibitory and shuttling functions of rhoGDI-3 and rhoGDI-1

AA Sequence

MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLA      1 - 70
KYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVH     71 - 140
REIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHH    141 - 210
LSWEWGLCICQDWKD                                                           211 - 225
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
20098615 2010 Application of gene network analysis techniques identifies AXIN1/PDIA2 and endoglin haplotypes associated with bicuspid aortic valve.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15513926 2005 Uncoupling of inhibitory and shuttling functions of rho GDP dissociation inhibitors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11967128 2002 RhoGDI-3 regulates RhoG and targets this protein to the Golgi complex through its unique N-terminal domain.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
9787082 1998 Human ARHGDIG, a GDP-dissociation inhibitor for Rho proteins: genomic structure, sequence, expression analysis, and mapping to chromosome 16p13.3.
More...