Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.54
PubTator Score 6.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 1.53798545009238E-22
ependymoma 2514 5.74050753489296E-21
atypical teratoid/rhabdoid tumor 1095 3.42115617688335E-12
glioblastoma 5572 1.54185925256427E-11
pilocytic astrocytoma 3086 2.21622563257487E-11
group 4 medulloblastoma 1875 2.48247067798588E-8
psoriasis 6685 5.65824924278538E-8
adult high grade glioma 2148 1.57307912425666E-6
ovarian cancer 8492 2.47881719007903E-5
astrocytoma 1493 2.85237860870974E-4
medulloblastoma, large-cell 6234 0.00210767915159327
gastric carcinoma 832 0.00448148442520453
primitive neuroectodermal tumor 3031 0.00484401660237056
subependymal giant cell astrocytoma 2287 0.0370888933399769

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -2.300 0.000
ependymoma -3.000 0.000
oligodendroglioma -1.900 0.000
glioblastoma -2.500 0.000
group 4 medulloblastoma -3.200 0.000
atypical teratoid/rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -1.600 0.002
primitive neuroectodermal tumor -1.800 0.005
adult high grade glioma -2.800 0.000
pilocytic astrocytoma -2.700 0.000
subependymal giant cell astrocytoma -2.123 0.037
gastric carcinoma -1.200 0.004
ovarian cancer -1.100 0.000
psoriasis -1.300 0.000

Synonym

Accession Q99819 Q4TT69 Q96S29 Rho GDI 3
Symbols RHOGDI-3

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20098615 Observational study of gene-disease association. (HuGE Navigator)
15513926 analysis of inhibitory and shuttling functions of rhoGDI-3 and rhoGDI-1

AA Sequence

MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLA      1 - 70
KYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVH     71 - 140
REIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHH    141 - 210
LSWEWGLCICQDWKD                                                           211 - 225
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
20098615 2010 Application of gene network analysis techniques identifies AXIN1/PDIA2 and endoglin haplotypes associated with bicuspid aortic valve.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15513926 2005 Uncoupling of inhibitory and shuttling functions of rho GDP dissociation inhibitors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11967128 2002 RhoGDI-3 regulates RhoG and targets this protein to the Golgi complex through its unique N-terminal domain.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
9787082 1998 Human ARHGDIG, a GDP-dissociation inhibitor for Rho proteins: genomic structure, sequence, expression analysis, and mapping to chromosome 16p13.3.
More...