Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.55
PubTator Score 6.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.800 1.6e-06
astrocytic glioma -1.600 2.4e-03
Astrocytoma, Pilocytic -2.700 1.5e-11
atypical teratoid / rhabdoid tumor -2.800 4.6e-11
ependymoma -1.800 6.5e-04
gastric carcinoma -1.200 4.5e-03
glioblastoma -2.500 1.5e-11
group 3 medulloblastoma -1.900 3.9e-03
medulloblastoma, large-cell -1.600 2.1e-03
oligodendroglioma -1.100 4.9e-02
ovarian cancer -1.100 2.5e-05
primitive neuroectodermal tumor -1.800 4.8e-03
psoriasis -1.300 5.7e-08
subependymal giant cell astrocytoma -2.123 3.7e-02

Gene RIF (3)

AA Sequence

MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLA      1 - 70
KYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVH     71 - 140
REIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHH    141 - 210
LSWEWGLCICQDWKD                                                           211 - 225
//

Text Mined References (14)

PMID Year Title