Property Summary

NCBI Gene PubMed Count 146
Grant Count 164
R01 Count 72
Funding $18,896,147.45
PubMed Score 282.11
PubTator Score 228.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.403 0.000
ovarian cancer 2.200 0.000

Synonym

Accession Q99816 Q9BUM5
Symbols TSG10
VPS23

Gene

PANTHER Protein Class (2)

PDB

1KPP   1KPQ   1M4P   1M4Q   1S1Q   2F0R   3IV1   3OBQ   3OBS   3OBU   3OBX   3P9G   3P9H   4EJE   4YC1   4ZNY  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
485342 confirmatory 0 / 3 / 1277 qHTS Validation Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101
485388 summary 0 / 0 / 0 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101: Summary
493005 confirmatory 2 / 1803 / 334923 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101
651599 confirmatory 17 / 70 / 494 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101: Hit Validation in TR assay
651600 confirmatory 163 / 197 / 221 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101: Hit Validation
651603 other 5 / 0 / 0 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101: Hit Validation in Viral Budding Asaay

Gene RIF (272)

PMID Text
26608825 Results show that TSG101 bidirectionally modulates cell invasion through regulating MMP-9 mRNA expression in different cell types.
26537625 TSG101 plays an important role in the development of hepatocellular carcinoma
26457367 PSAP motif of OFR3 is required for hepatitis E virus exit and interaction with host TSG101.
26400331 Expression of tsg101 mRNA and of TSG101 protein were significantly higher in the oxaliplatin resistant cell line than parent HT-29 cels.
26317613 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
26268989 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
26268989 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
26268989 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
26268989 siRNA knockdown of TSG101 impairs terminal cleavage of p24/p2 to p24 and HIV release is impaired (from sequential transfection of siRNA followed by plasmid HIVdeltaEnv (pBH10)); HIV release is enhanced by TSG101
26109641 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
More...

AA Sequence

MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNI      1 - 70
PICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPP     71 - 140
VFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPV    141 - 210
TTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQE    211 - 280
VAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALR    281 - 350
RGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY                                  351 - 390
//

Text Mined References (156)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26608825 2015 TSG101, a tumor susceptibility gene, bidirectionally modulates cell invasion through regulating MMP-9 mRNA expression.
26537625 2015 TSG101 Silencing Suppresses Hepatocellular Carcinoma Cell Growth by Inducing Cell Cycle Arrest and Autophagic Cell Death.
26457367 2015 Replacement of the hepatitis E virus ORF3 protein PxxP motif with heterologous late domain motifs affects virus release via interaction with TSG101.
26400331 2015 Gene and protein expression in the oxaliplatin-resistant HT29/L-OHP human colon cancer cell line.
26066081 2015 WASH and Tsg101/ALIX-dependent diversion of stress-internalized EGFR from the canonical endocytic pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25510868 2015 Functional Interaction Between the ESCRT-I Component TSG101 and the HSV-1 Tegument Ubiquitin Specific Protease.
25416956 2014 A proteome-scale map of the human interactome network.
25330247 2014 Interaction with Tsg101 is necessary for the efficient transport and release of nucleocapsids in marburg virus-infected cells.
More...