Property Summary

NCBI Gene PubMed Count 154
PubMed Score 298.92
PubTator Score 228.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
breast carcinoma 1638
Disease Target Count P-value
ovarian cancer 8520 3.8e-06
Multiple myeloma 1332 1.1e-04
Disease Target Count
Familial cancer of breast 12

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.403 1.1e-04
ovarian cancer -1.300 3.8e-06

Gene RIF (170)

AA Sequence

MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNI      1 - 70
PICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPP     71 - 140
VFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPV    141 - 210
TTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQE    211 - 280
VAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALR    281 - 350
RGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY                                  351 - 390
//

Text Mined References (166)

PMID Year Title