Property Summary

NCBI Gene PubMed Count 342
Grant Count 144
R01 Count 83
Funding $11,018,519.24
PubMed Score 166.06
PubTator Score 520.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q99814 Q86VA2 Q99630 EPAS-1
Symbols HLF
MOP2
ECYT4
HIF2A
PASD2
bHLHe73

Gene

PDB

1P97   2A24   3F1N   3F1O   3F1P   3H7W   3H82   4GHI   4GS9   4PKY   4XT2   5KIZ   5T0T  

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
624352 screening 2626 / 0 / 361542 uHTS identification of HIF-2a Inhibitors in a luminesence assay
624357 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of HIF-2a
651580 screening 982 / 0 / 777 Single concentration confirmation of uHTS identification of HIF-2a Inhibitors in a luminesence assay
651581 confirmatory 25 / 0 / 184 Dose response confirmation of uHTS identification of HIF-2a Inhibitors in screening - selectivity counterscreen assays
652011 confirmatory 10 / 0 / 57 SAR Analysis small molecule inhibitors of HIF-1a in a panel assay

Gene RIF (322)

PMID Text
27025692 Demonstrate that mTORC1 inhibition leads to AKT activation and an increase in HIF2A expression, leading to chondrogenic differentiation of amniotic fluid stem cells.
27001172 HIF-dependent regulation of ITGA6 is one mechanism by which sorting for CD49f (+) cells enhances cancer stem cells.
26898802 Akey role for HIF-2alpha-induced Ptpmt1 upregulation in proliferation, survival and glucose metabolism of erythroleukemia cells.
26886654 overexpression predicts poor prognosis in gastric carcinoma [meta-analysis]
26883865 results are consistent with distant shared ancestry for African and Asian EPAS1 haplotypes and Denisovan adaptive introgression
26846782 High HIF-2alpha expression is associated with papillary thyroid carcinoma.
26842802 Findings indicated that HIF-2alpha promotes epithelial-mesenchymal transition in pancreatic cancer by regulating Twist2 binding to the promoter of E-cadherin.
26837714 Most human soft tissue sarcomas have lower levels of EPAS1 expression relative to normal tissue.
26782458 HIF-2alpha is highly expressed in lung cancer stem cells, which may lead to radioresistance. In conclusion, HIF-2alpha is a potential prognostic marker for lung cancer
26647960 HBV induces the HIF2alpha expression through its encoded protein HBx. This upregulates the HIF-2alpha expression by binding to the pVHL activating the NF-kappaB signaling pathway
More...

AA Sequence

MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLL      1 - 70
SSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDH     71 - 140
EEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNS    141 - 210
LCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEF    211 - 280
YHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKN    281 - 350
DVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQN    351 - 420
FEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYT    421 - 490
SLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTP    491 - 560
QHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSS    561 - 630
MGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMV    631 - 700
ALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPM    701 - 770
RGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELT    771 - 840
RYDCEVNVPVLGSSTLLQGGDLLRALDQAT                                            841 - 870
//

Text Mined References (343)

PMID Year Title
27025692 2016 Rapamycin-Induced Hypoxia Inducible Factor 2A Is Essential for Chondrogenic Differentiation of Amniotic Fluid Stem Cells.
27001172 2016 ITGA6 is directly regulated by hypoxia-inducible factors and enriches for cancer stem cell activity and invasion in metastatic breast cancer models.
26898802 2016 Ptpmt1 induced by HIF-2? regulates the proliferation and glucose metabolism in erythroleukemia cells.
26886654 2016 Clinicopathological Differences and Prognostic Value of Hypoxia-Inducible Factor-2? Expression for Gastric Cancer: Evidence From Meta-Analysis.
26883865 2016 Wide distribution and altitude correlation of an archaic high-altitude-adaptive EPAS1 haplotype in the Himalayas.
26846782 2016 Expression of HIF-1? and HIF-2? correlates to biological and clinical significance in papillary thyroid carcinoma.
26842802 2016 HIF-2? promotes epithelial-mesenchymal transition through regulating Twist2 binding to the promoter of E-cadherin in pancreatic cancer.
26837714 2016 Epigenetic re-expression of HIF-2? suppresses soft tissue sarcoma growth.
26782458 2015 High expression of HIF-2? and its anti-radiotherapy effect in lung cancer stem cells.
26647960 2016 Hepatitis B virus induces hypoxia-inducible factor-2? expression through hepatitis B virus X protein.
More...