Property Summary

Ligand Count 42
NCBI Gene PubMed Count 396
PubMed Score 180.50
PubTator Score 520.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.244 1.3e-03
atypical teratoid / rhabdoid tumor -1.600 1.8e-04
breast carcinoma -1.200 8.8e-04
COPD -1.300 3.0e-03
ductal carcinoma in situ -1.400 4.7e-04
intraductal papillary-mucinous neoplasm ... -1.200 2.0e-02
invasive ductal carcinoma -2.000 2.3e-03
lung adenocarcinoma -1.800 1.5e-16
lung cancer -3.400 4.2e-07
lung carcinoma -1.800 1.4e-15
malignant mesothelioma -2.100 2.2e-08
medulloblastoma, large-cell -2.000 5.0e-05
mucosa-associated lymphoid tissue lympho... 2.080 3.4e-02
nasopharyngeal carcinoma -1.600 1.5e-04
non-small cell lung cancer -1.997 3.7e-25
oligodendroglioma 1.800 4.5e-03
osteosarcoma -1.467 4.3e-02
ovarian cancer -2.300 6.4e-05
primitive neuroectodermal tumor -1.100 2.6e-02
sonic hedgehog group medulloblastoma -1.200 1.2e-02
tuberculosis -2.100 1.3e-05

Protein-protein Interaction (2)

Gene RIF (373)

AA Sequence

MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLL      1 - 70
SSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDH     71 - 140
EEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNS    141 - 210
LCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEF    211 - 280
YHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKN    281 - 350
DVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQN    351 - 420
FEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYT    421 - 490
SLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTP    491 - 560
QHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSS    561 - 630
MGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMV    631 - 700
ALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPM    701 - 770
RGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELT    771 - 840
RYDCEVNVPVLGSSTLLQGGDLLRALDQAT                                            841 - 870
//

Text Mined References (397)

PMID Year Title