Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $23,445.67
PubMed Score 6.19
PubTator Score 17.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis 1.300 0.001
osteosarcoma 2.321 0.000
glioblastoma 1.100 0.006
non primary Sjogren syndrome sicca 1.200 0.018
lung adenocarcinoma 1.700 0.000
facioscapulohumeral dystrophy 2.000 0.048

Synonym

Accession Q99811 Q5SZB5 Q9UIB3
Symbols PMX2
PRX2

Gene

 Grant Application (1)

Gene RIF (4)

PMID Text
21385867 Model for the exceptional reactivity of peroxiredoxins 2 and 3 with hydrogen peroxide: a kinetic and computational study.
20634891 Observational study of gene-disease association. (HuGE Navigator)
17964282 Valsartan, a selective Ang II type 1 (AT1) receptor blocker, and N-acetylcysteine, an antioxidant, inhibited both of these modifications, indicating the contribution of AT1 receptor and reactive oxygen species to oxidation of Prx2.
11893718 Encodes homeobox transcription factors that are expressed during vasculogenesis.

AA Sequence

MDSAAAAFALDKPALGPGPPPPPPALGPGDCAQARKNFSVSHLLDLEEVAAAGRLAARPGARAEAREGAA      1 - 70
REPSGGSSGSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARR     71 - 140
VNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYST    141 - 210
VPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN                               211 - 253
//

Text Mined References (12)

PMID Year Title
21385867 2011 Model for the exceptional reactivity of peroxiredoxins 2 and 3 with hydrogen peroxide: a kinetic and computational study.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
17964282 2007 Oxidation of Prx2 and phosphorylation of GRP58 by angiotensin II in human coronary smooth muscle cells identified by 2D-DIGE analysis.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
15496970 2005 A new translocation t(9;11)(q34;p15) fuses NUP98 to a novel homeobox partner gene, PRRX2, in a therapy-related acute myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12713735 2003 GeneChip microarrays facilitate identification of Protease Nexin-1 as a target gene of the Prx2 (S8) homeoprotein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...