Property Summary

NCBI Gene PubMed Count 114
Grant Count 86
R01 Count 64
Funding $7,260,888.52
PubMed Score 397.32
PubTator Score 325.37

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99808 B3KQV7 B3KQY5 Q5T9W9 Q9UJY2
Symbols ENT1

Gene

PANTHER Protein Class (1)

Gene RIF (103)

PMID Text
26944860 High expression of hENT1 appears to predict a good response to decitabine and a prolonged survival in higher-risk myelodysplastic syndrome patients treated with decitabine.
26431496 Studies indicate that an autophagy response induced by hepatitis C virus (HCV) in a cell culture reduces ribavirin (RBV) uptake and antiviral activity by diminishing the surface expression of nucleoside transporters) member 1 (ENT1).
26406980 The Role of Flexible Loops in Folding, Trafficking and Activity of Equilibrative Nucleoside Transporters.
26279293 The identification of ITPA protective and SLC29A1 risk genotypes still appears to be a current methodology in Ribavirin dosing during hepatitis C virus therapy with direct acting antiviral agents
26083014 RNA expression of deoxycytidine kinase (DCK), human equilibrative nucleoside transporter-1 (ENT1) and ribonucleotide reductase M1 (RRM1) were significantly higher and cytidine deaminase (CDA) was significantly lower in ex vivo Ara-C sensitive samples.
26040919 SNPS in SLC29A1 were not associated with increased risk of post-traumatic epilepsy development after brain injury.
25906447 ENT1 expression profile did not serve as a useful prognostic biomarker and therapeutic target for surgically resected patients with ampullary carcinoma.
25896650 results establish Augustine as a new blood group system and place SLC29A1 as a new candidate gene for idiopathic disorders characterized with ectopic calcification/mineralization.
25725289 Adenosine A1 receptor activation increases ENT1 activity via protein kinase C.
25533931 These findings indicate that the decitabine metabolic pathway affects its therapeutic effects, lower hENT1 expression may induce primary resistance and down-regulated DCK expression may be related to secondary resistance.
More...

AA Sequence

MTTSHQPQDRYKAVWLIFFMLGLGTLLPWNFFMTATQYFTNRLDMSQNVSLVTAELSKDAQASAAPAAPL      1 - 70
PERNSLSAIFNNVMTLCAMLPLLLFTYLNSFLHQRIPQSVRILGSLVAILLVFLITAILVKVQLDALPFF     71 - 140
VITMIKIVLINSFGAILQGSLFGLAGLLPASYTAPIMSGQGLAGFFASVAMICAIASGSELSESAFGYFI    141 - 210
TACAVIILTIICYLGLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESH    211 - 280
SIKAILKNISVLAFSVCFIFTITIGMFPAVTVEVKSSIAGSSTWERYFIPVSCFLTFNIFDWLGRSLTAV    281 - 350
FMWPGKDSRWLPSLVLARLVFVPLLLLCNIKPRRYLTVVFEHDAWFIFFMAAFAFSNGYLASLCMCFGPK    351 - 420
KVKPAEAETAGAIMAFFLCLGLALGAVFSFLFRAIV                                      421 - 456
//

Text Mined References (121)

PMID Year Title
26944860 2016 High expression of the human equilibrative nucleoside transporter 1 gene predicts a good response to decitabine in patients with myelodysplastic syndrome.
26431496 2015 ENT1 and treatment of viral diseases.
26406980 2015 The Role of Flexible Loops in Folding, Trafficking and Activity of Equilibrative Nucleoside Transporters.
26279293 2015 ITPA and SLC29A1 Genotyping for the Prediction of Ribavirin Dose Reduction in Anti-HCV Triple Therapy with Protease Inhibitors.
26083014 2015 RNA expression of genes involved in cytarabine metabolism and transport predicts cytarabine response in acute myeloid leukemia.
26040919 2015 Genetic variation in the adenosine regulatory cycle is associated with posttraumatic epilepsy development.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25906447 2015 Prognostic Value of Excision Repair Cross-Complementing Gene 1, Dihydropyrimidine Dehydrogenase, and Human Equilibrative Nucleotide Transporter 1 Expression and Their Implications for Adjuvant Treatment in Patients With Ampullary Carcinoma.
25896650 2015 Lack of the nucleoside transporter ENT1 results in the Augustine-null blood type and ectopic mineralization.
25725289 2015 Adenosine A1 receptor activation modulates human equilibrative nucleoside transporter 1 (hENT1) activity via PKC-mediated phosphorylation of serine-281.
More...