Property Summary

NCBI Gene PubMed Count 23
PubMed Score 153.45
PubTator Score 25.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
COENZYME Q10 DEFICIENCY, PRIMARY, 8 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.1e-09
malignant mesothelioma 3232 4.5e-06
psoriasis 6694 3.8e-05
Disease Target Count Z-score Confidence
Coenzyme Q10 deficiency disease 8 0.0 5.0

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 4.5e-06
osteosarcoma -2.366 2.1e-09
psoriasis -1.900 3.8e-05

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQ      1 - 70
MAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVA     71 - 140
VEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVA    141 - 210
IYLSERL                                                                   211 - 217
//

Text Mined References (29)

PMID Year Title