Property Summary

NCBI Gene PubMed Count 22
Grant Count 9
R01 Count 5
Funding $878,556.75
PubMed Score 145.48
PubTator Score 25.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.900 0.000
osteosarcoma -2.366 0.000

Gene RIF (5)

PMID Text
25339443 Mitochondrial COQ9 is a lipid-binding protein that associates with COQ7 to enable coenzyme Q biosynthesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
19135146 The siRNA-mediated knock down leads to an increase in cytoplasmic superoxide dismutase (SOD1) mRNA levels and activity
18927074 action of clioquinol on several age-dependent neurodegenerative diseases with distinct etiologies might result from a slowing down of the aging process through action of the drug on CLK-1.

AA Sequence

MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQ      1 - 70
MAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVA     71 - 140
VEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVA    141 - 210
IYLSERL                                                                   211 - 217
//

Text Mined References (29)

PMID Year Title
26084283 2015 Rescue of primary ubiquinone deficiency due to a novel COQ7 defect using 2,4-dihydroxybensoic acid.
25961505 2015 A nuclear role for the respiratory enzyme CLK-1 in regulating mitochondrial stress responses and longevity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25339443 2014 Mitochondrial COQ9 is a lipid-binding protein that associates with COQ7 to enable coenzyme Q biosynthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270420 2013 ADCK4 mutations promote steroid-resistant nephrotic syndrome through CoQ10 biosynthesis disruption.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19135146 2009 Superoxide dismutase is regulated by LAMMER kinase in Drosophila and human cells.
More...