Property Summary

NCBI Gene PubMed Count 90
PubMed Score 130.31
PubTator Score 199.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -3.400 2.8e-08
osteosarcoma 1.544 6.2e-08
cystic fibrosis 1.071 3.8e-04
intraductal papillary-mucinous neoplasm ... 1.600 2.5e-03
lung cancer -1.800 2.7e-03
group 3 medulloblastoma -1.100 1.2e-02
invasive ductal carcinoma -1.208 1.9e-02
ductal carcinoma in situ 1.700 4.8e-02
ovarian cancer -4.000 2.4e-20
pituitary cancer -1.100 5.0e-05

 GO Component (2)

Gene RIF (74)

PMID Text
26841725 The androgen-regulated homeodomain transcription factor NKX3.1 plays roles in early prostate development and functions as a prostate-specific tumor suppressor.
26689514 the association between the down-regulation of PTEN and NKX3.1 genes contributed to prostate tumorigenesis.
26148677 An NKX3.1 binding site polymorphism in the l-plastin promoter leads to differential gene expression in human prostate cancer
25977336 Analysis of prostate cancer tissues showed that the presence of a TMPRSS2-ERG rearrangement was highly correlated with lower levels of NKX3.1 expression consistent with the role of NKX3.1 as a suppressor of the pathogenic gene rearrangement.
25777618 NKX3.1 and DYRK1B were shown to interact via the DYRK1B kinase domain. In vitro kinase assay showed that DYRK1B phosphorylated NKX3.1 at serine 185, a residue critical for NKX3.1 steady-state turnover.
25360740 NKX3.1 expression mediate beta-catenin and E-cadherin association and cell migration in prostate cells.
24996432 NKX3.1 labelling is limited to estrogen/progesterone/androgen receptor-positive breast carcinomas.
24894197 Our results indicate that variation in NKX3.1 expression combined with selenium or vitamin E treatment modifies the risk of prostate cancer.
24779299 Loci at 8q24 and 8q21 could influence susceptibility to prostate cancer in the northern Chinese population
24434284 Androgens and NKX3.1 expression regulate the progression of the cell cycle and concurrently activate the DNA damage response.
24418414 These observations imply that the frequently noted loss-of-function of NKX3.1 cooperates with the activation of TMPRSS2-ERG fusions in prostate tumorigenesis.
23890999 NKX3.1 may enhance DNA integrity in prostate stem cells and may help to explain how cells differ in their sensitivity to DNA damage.
23867798 multiple NKX3.1 binding sites were found in the RAMP1 locus in human prostate cancer cells and in the normal mouse prostate.
23836514 NKX3-1 is a tumor suppressor gene through direct regulation of the cell cycle and growth/survival pathways.
23786676 Id4 regulates NKX3.1, Sox9 and PTEN.
23129228 Pim-1-mediated NKX3.1 stabilization may be important in maintaining normal cellular homeostasis in normal prostate epithelial cells, and may maintain basal NKX3.1 protein levels in prostate cancer cells.
22910912 Proline-mediated proteasomal degradation of the prostate-specific tumor suppressor NKX3.1.
22848398 Transcriptional activation of prostate specific homeobox gene NKX3-1 in subsets of T-cell lymphoblastic leukemia (T-ALL).
22741436 PDLIM5 (rs17021918,T), SLC22A3 (rs9364554,C) and NKX3-1 (rs1512268,A) SNPs might not be associated with prostate cancer in Chinese men.
22484818 NKX3.1 and MYC coregulate prostate tumorigenesis by converging on, and crossregulating, a common set of target genes.
22344708 loss of NKX3-1 may be a potential biomarker for occult lymph node metastasis and poor prognosis in oral squamous cell carcinoma.
22179513 NKX3.1 inhibits IGF-1R expression and its signalling pathway in human prostatic carcinoma PC3 cells.
22083957 NKX3-1 and androgen receptor directly regulate each other in a feed-forward regulatory loop.
21945437 androgen regulated NKX3.1 maintains an active DNA damage response at the intra S progression and contributes to the chemotherapeutic resistance of prostate cancer cells to DNA damaging compounds.
21456068 Copy number gain of the MIR151 gene and/or loss of the NKX3-1 gene in the primary tumor may indicate the presence of metastatic prostate cancer.
20855495 in human TAL1-expressing T-ALL cell lines, TAL1 directly activates NKX3.1
20842667 ETS1 upregulation of NKX3.1 expression in LNCaP cells is mediated in part via its interaction with an EBS located in the NKX3.1 5' proximal promoter.
20716579 results suggest that functional variant rs11781886 in 5'-UTR of NKX3.1 can affect its transcription by altering the binding affinity of a transcriptional factor Sp1, and might result in PC susceptibility by lowering expression of NKX3.1 in the prostate
20588175 The addition of NKX3.1 protein staining to a panel of markers, if applied in the appropriate clinicopathologic context, may add diagnostic value in the diagnosis of metastatic lesions of unknown primary origin.
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
20479932 The prostate-specific tumor suppressor gene Nkx3.1 was controlled by ERG and ESE3 both directly and through induction of EZH2.
20395202 NKX3.1 activates cellular response to DNA damage
20363913 Nkx3.1 has a role in bacterial prostatitis and its progression to inflammation and neoplasia
19886863 Androgen regulation of the prostatic tumour suppressor NKX3.1 is mediated by its 3' untranslated region
19797053 MYOCD can discriminate among several juxtaposed CArG elements, presumably through its novel partnership with NKX3.1, to optimally transactivate the human ACTG2 promoter
19780584 NKX3.1 constructs with acidic domain phosphorylation site threonine residues (89 and 93) mutated to glutamate were 4 degrees C more stable than homeodomain alone
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19462257 NKX3.1 might exert its function by regulating the expression of relative genes in prostate development and carcinogenesis.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19266349 Nkx3.1 and p27(KIP1) cooperate in proliferation inhibition and apoptosis induction in human androgen-independent prostate cancer cells.
19263243 With deletion mutation analysis, plasmid construction, EMSA and oligonucleotide decoy technique, two Sp1-elements which located between +29 to +43 and -60 to -46 of NKX3.1 gene were identified and proven to be functional elements.
19258508 The growth-suppressive effects of NKX3.1 in prostate cells are mediated, in part, by activation of IGFBP-3 expression.
18974119 regulation of VEGF-C expression by NKX3.1 provides a possible mechanism by which the loss of NKX3.1 protein level leads to lymphangiogenesis in the late stages of advanced prostate cancer
18757402 cellular levels of the NKX3.1 tumor suppressor are affected by inflammatory cytokines that target COOH-terminal serine residues to activate ubiquitination and protein degradation
18454873 These results suggested that two functional NKX3.1 binding sites located at -1848 to -1836 and -803 to -791 upstream of the PCAN1 gene were involved in the positive regulation of PCAN1 gene transcription by NKX3.1.
18360715 In LNCaP NKX3.1 most probably plays the role of an androgen-regulated transcription factor whose down-regulation is paralleled by anti-proliferative and pro-apoptotic effects.
18296735 identified novel protein-protein interacting domains within Nkx3.1 and serum response factor
18077445 NKX3.1 can be ubiquitinated by TOPORS in vitro and in vivo, and overexpression of TOPORS leads to NKX3.1 proteasomal degradation in prostate cancer cells
17486276 The present study demonstrates that re-expression of Nkx3.1 enhances 17beta-estradiol anti-tumor action in PC3 human prostate cancer cells.
17234752 NKX3.1 interacts with Topo I to enhance formation of the Topo I-DNA complex and to increase Topo I cleavage of DNA.
17202838 NKX3.1 is down-regulated by p53 over-expression in prostate cancer cells
17108105 Reduced NKX3.1 protein levels early in human prostate carcinogenesis may facilitate both proliferation and DNA damage in atrophic and PIN cells. Monoallelic deletions on chromosome 8p are associated with advanced invasive and aggressive disease.
16845664 There is a functional inhibitory cis-element between -362 and -343 in the upstream of NKX3.1 gene, a prostate-specific homeobox gene related to prostate development and prostate cancer. It may play a role in downregulating NKX3.1 gene transcription.
16817226 These studies demonstrate that the NKX3.1 gene is a direct target of retinoid receptors and suggest that androgen regulation of NKX3.1 expression is mediated in part by the 3'untranslated region.
16814806 Identifies two novel interaction motifs with SRF and one novel intra-protein interaction involving NKX3-1 homeodomain
16697957 PTEN loss causes reduced NKX3.1 expression in both murine and human prostate cancers.
16581776 NKX3-1 is regulated by protein kinase CK2 in prostate tumor cells.
16519150 NKX3.1 is not only the prostate-specific homeobox gene, but is the epithelia-cell specific gene of prostate. It may play an important role in the development of prostatic carcinoma.
16442598 Observational study of gene-disease association. (HuGE Navigator)
16413692 NKX3.1 expression is significantly decreased in prostate cancer patients but that was not correlated with prostate cancer progression and was not associated with advanced stage. Thus, NKX3.1 expression is not a clinically valuable prognostic factor.
16397218 Germ-line sequence variants in NKX3.1 may play a role in susceptibility to hereditary prostate cancer and underscore a role for NKX3.1 as a prostate cancer gatekeeper.
16382041 Nkx3.1 and Egr1 regulate gene programs involved in distinct aspects of prostate tumorigenesis [review]
16201967 Nkx3.1 negatively regulates Sp-mediated transcription via the tethering of histone deacetylases and/or by inhibiting the association of Sp proteins with co-activators.
15880262 We found that the 20 bp inhibitory decoy could enhance NKX3.1 promoter activity, and RT-PCR and Western blot analysis revealed that NKX3.1 expression was up-regulated effectively by the transfection with the 20 bp inhibitory decoy.
15734999 Even in the presence of allelic loss, NKX3.1 expression is reduced over a wide range in prostate cancer.
15691383 Down-regulation of NKX3.1 expression is not caused by promoter hypermethylation in testicular germ cell tumors and prostate carcinomas.
15523673 identified novel protein-protein interaction domains within NKX-3.1 and PDEF that operate in concert with their respective DNA binding domains to mediate functional interactions between these growth regulatory transcription factors
15311057 NKX3.1 does not function as a typical tumor suppressor protein in prostate cancer but it may still have important regulatory roles during prostate cancer progression
14648854 Nkx3.1 homeobox gene has roles in prostate organogenesis and carcinogenesis (review)
14633588 NKX3.1 is essential for normal testis function and that its loss of expression is highly associated with the invasive phenotype of testicular germ cell tumors.
12661036 Expression of NKX3.1 is highly restricted and is found primarily in benign and malignant prostatic epithelial cells and also in normal testis and lobular carcinoma of the breast.
12450213 smooth muscle gamma actin gene activity in prostate epithelia is due, in part, to the androgen-dependent expression of Nkx 3.1
11980664 Observational study of gene-disease association. (HuGE Navigator)
11809674 NKX-3.1 interacts with prostate-derived Ets factor and regulates the activity of the PSA promoter.

AA Sequence

MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAG      1 - 70
AQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELE     71 - 140
RKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASL    141 - 210
VSVYNSYPYYPYLYCVGSWSPAFW                                                  211 - 234
//

Text Mined References (91)

PMID Year Title
26841725 2016 Regulating NKX3.1 stability and function: Post-translational modifications and structural determinants.
26689514 Concurrent Down-Regulation of PTEN and NKX3.1 Expression in Iranian Patients with Prostate Cancer.
26148677 2016 An NKX3.1 binding site polymorphism in the l-plastin promoter leads to differential gene expression in human prostate cancer.
25977336 2015 NKX3.1 Suppresses TMPRSS2-ERG Gene Rearrangement and Mediates Repair of Androgen Receptor-Induced DNA Damage.
25777618 2015 The Tumor Suppressor NKX3.1 Is Targeted for Degradation by DYRK1B Kinase.
25360740 2014 TNF?-mediated loss of ?-catenin/E-cadherin association and subsequent increase in cell migration is partially restored by NKX3.1 expression in prostate cells.
24996432 2014 NKX3.1 is expressed in ER-positive and AR-positive primary breast carcinomas.
24894197 2014 A functional variant in NKX3.1 associated with prostate cancer risk in the Selenium and Vitamin E Cancer Prevention Trial (SELECT).
24779299 2014 Study of genetic variants of 8q21 and 8q24 associated with prostate cancer in Jing-Jin residents in northern China.
24434284 2014 DNA damage response (DDR) via NKX3.1 expression in prostate cells.
24418414 2014 Loss of the NKX3.1 tumorsuppressor promotes the TMPRSS2-ERG fusion gene expression in prostate cancer.
23890999 2013 Functional activation of ATM by the prostate cancer suppressor NKX3.1.
23867798 2013 RAMP1 is a direct NKX3.1 target gene up-regulated in prostate cancer that promotes tumorigenesis.
23836514 2013 Targeted induction of endogenous NKX3-1 by small activating RNA inhibits prostate tumor growth.
23786676 2013 Id4 deficiency attenuates prostate development and promotes PIN-like lesions by regulating androgen receptor activity and expression of NKX3.1 and PTEN.
23129228 2013 Stabilization of the prostate-specific tumor suppressor NKX3.1 by the oncogenic protein kinase Pim-1 in prostate cancer cells.
22910912 2012 Proline-mediated proteasomal degradation of the prostate-specific tumor suppressor NKX3.1.
22848398 2012 Transcriptional activation of prostate specific homeobox gene NKX3-1 in subsets of T-cell lymphoblastic leukemia (T-ALL).
22741436 2012 [Association of prostate cancer with PDLIM5, SLC22A3 and NKX3-1 in Chinese men].
22484818 2012 Nkx3.1 and Myc crossregulate shared target genes in mouse and human prostate tumorigenesis.
22344708 2012 Loss of NKX3-1 as a potential marker for an increased risk of occult lymph node metastasis and poor prognosis in oral squamous cell carcinoma.
22179513 2012 The inhibitory effects of NKX3.1 on IGF-1R expression and its signalling pathway in human prostatic carcinoma PC3 cells.
22083957 2012 Integration of regulatory networks by NKX3-1 promotes androgen-dependent prostate cancer survival.
21945437 2011 NKX3.1 contributes to S phase entry and regulates DNA damage response (DDR) in prostate cancer cell lines.
21456068 2011 Chromosome 8 markers of metastatic prostate cancer in African American men: gain of the MIR151 gene and loss of the NKX3-1 gene.
21056661 2011 Hypoxia enhances transcriptional activity of androgen receptor through hypoxia-inducible factor-1? in a low androgen environment.
20855495 2010 NKX3.1 is a direct TAL1 target gene that mediates proliferation of TAL1-expressing human T cell acute lymphoblastic leukemia.
20842667 2011 ETS1 regulates NKX3.1 5' promoter activity and expression in prostate cancer cells.
20716579 2010 A functional variant in NKX3.1 associated with prostate cancer susceptibility down-regulates NKX3.1 expression.
20676098 2010 Genome-wide association study identifies five new susceptibility loci for prostate cancer in the Japanese population.
20599703 2010 NKX3.1 potentiates TNF-alpha/CHX-induced apoptosis of prostate cancer cells through increasing caspase-3 expression and its activity.
20588175 2010 NKX3.1 as a marker of prostatic origin in metastatic tumors.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
20479932 2010 ETS transcription factors control transcription of EZH2 and epigenetic silencing of the tumor suppressor gene Nkx3.1 in prostate cancer.
20395202 2010 NKX3.1 activates cellular response to DNA damage.
20363913 2010 Loss of Nkx3.1 expression in bacterial prostatitis: a potential link between inflammation and neoplasia.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
19886863 2010 Androgen regulation of the prostatic tumour suppressor NKX3.1 is mediated by its 3' untranslated region.
19797053 2009 Myocardin-dependent activation of the CArG box-rich smooth muscle gamma-actin gene: preferential utilization of a single CArG element through functional association with the NKX3.1 homeodomain protein.
19780584 2009 Interactions of the acidic domain and SRF interacting motifs with the NKX3.1 homeodomain.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
19597465 2009 Loss of Nkx3.1 leads to the activation of discrete downstream target genes during prostate tumorigenesis.
19462257 2010 Gene expression profiles in the PC-3 human prostate cancer cells induced by NKX3.1.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19266349 2009 Nkx3.1 and p27(KIP1) cooperate in proliferation inhibition and apoptosis induction in human androgen-independent prostate cancer cells.
19263243 2009 Identification of Sp1-elements in the promoter region of human homeobox gene NKX3.1.
19258508 2009 NKX3.1 activates expression of insulin-like growth factor binding protein-3 to mediate insulin-like growth factor-I signaling and cell proliferation.
18974119 2008 Loss of NKX3.1 favors vascular endothelial growth factor-C expression in prostate cancer.
18794125 2008 Nkx3-1 and LEF-1 function as transcriptional inhibitors of estrogen receptor activity.
18757402 2008 Inflammatory cytokines induce phosphorylation and ubiquitination of prostate suppressor protein NKX3.1.
18454873 2008 Characterization of two functional NKX3.1 binding sites upstream of the PCAN1 gene that are involved in the positive regulation of PCAN1 gene transcription.
18360715 2008 Functional analysis of NKX3.1 in LNCaP prostate cancer cells by RNA interference.
18296735 2008 Structural and functional analysis of domains mediating interaction between the bagpipe homologue, Nkx3.1 and serum response factor.
18077445 2008 Ubiquitination by TOPORS regulates the prostate tumor suppressor NKX3.1.
17488276 2007 Inhibition of mitochondrial function in astrocytes: implications for neuroprotection.
17486276 2007 Expression of Nkx3.1 enhances 17beta-estradiol anti-tumor action in PC3 human prostate cancer cells.
17234752 2007 NKX3.1 homeodomain protein binds to topoisomerase I and enhances its activity.
17202838 2006 p53 overexpression represses androgen-mediated induction of NKX3.1 in a prostate cancer cell line.
17108105 2006 Decreased NKX3.1 protein expression in focal prostatic atrophy, prostatic intraepithelial neoplasia, and adenocarcinoma: association with gleason score and chromosome 8p deletion.
16845664 2006 Identification of an inhibitory cis-element in the promoter region of human homeobox gene NKX3.1.
16817226 2006 Transcriptional regulation of the homeobox gene NKX3.1 by all-trans retinoic acid in prostate cancer cells.
16814806 2006 Physical and functional interactions between the prostate suppressor homeoprotein NKX3.1 and serum response factor.
16697957 2006 NKX3.1 stabilizes p53, inhibits AKT activation, and blocks prostate cancer initiation caused by PTEN loss.
16581776 2006 NKX3.1 is regulated by protein kinase CK2 in prostate tumor cells.
16519150 2006 [The specific expression profile of homeobox gene NKX3.1 mRNA and protein in prostate tissues and its relationship with primary prostate cancer].
16442598 2006 Effect of homeodomain protein NKX3.1 R52C polymorphism on prostate gland size.
16413692 2006 Analysis of NKX3.1 expression in prostate cancer tissues and correlation with clinicopathologic features.
16397218 2006 Germ-line mutation of NKX3.1 cosegregates with hereditary prostate cancer and alters the homeodomain structure and function.
16382041 2005 Mechanisms of prostate tumorigenesis: roles for transcription factors Nkx3.1 and Egr1.
16201967 2006 Nkx3.1 binds and negatively regulates the transcriptional activity of Sp-family members in prostate-derived cells.
15880262 2005 Up-regulation of NKX3.1 expression and inhibition of LNCaP cell proliferation induced by an inhibitory element decoy.
15734999 2005 Deletion, methylation, and expression of the NKX3.1 suppressor gene in primary human prostate cancer.
15691383 2005 The loss of NKX3.1 expression in testicular--and prostate--cancers is not caused by promoter hypermethylation.
15523673 2005 Structural and functional analysis of domains mediating interaction between NKX-3.1 and PDEF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15311057 2004 Analysis of androgen regulated homeobox gene NKX3.1 during prostate carcinogenesis.
14648854 2003 Roles of the Nkx3.1 homeobox gene in prostate organogenesis and carcinogenesis.
14633588 2003 NKX3.1 expression is lost in testicular germ cell tumors.
12972618 2003 Purification and identification of a novel complex which is involved in androgen receptor-dependent transcription.
12661036 2003 Expression of NKX3.1 in normal and malignant tissues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450213 2002 The smooth muscle gamma-actin gene is androgen responsive in prostate epithelia.
11980664 2002 Occurrence of NKX3.1 C154T polymorphism in men with and without prostate cancer and studies of its effect on protein function.
11809674 2002 NKX-3.1 interacts with prostate-derived Ets factor and regulates the activity of the PSA promoter.
11137288 2000 Full-length cDNA sequence and genomic organization of human NKX3A - alternative forms and regulation by both androgens and estrogens.
11085535 2000 Loss of NKX3.1 expression in human prostate cancers correlates with tumor progression.
10993896 2000 The smooth muscle gamma-actin gene promoter is a molecular target for the mouse bagpipe homologue, mNkx3-1, and serum response factor.
10559189 1999 The homeodomain protein NK-3 recruits Groucho and a histone deacetylase complex to repress transcription.
9537602 1998 Isolation and androgen regulation of the human homeobox cDNA, NKX3.1.
9377551 1997 Coding region of NKX3.1, a prostate-specific homeobox gene on 8p21, is not mutated in human prostate cancers.
9226374 1997 A novel human prostate-specific, androgen-regulated homeobox gene (NKX3.1) that maps to 8p21, a region frequently deleted in prostate cancer.