Property Summary

NCBI Gene PubMed Count 90
Grant Count 217
R01 Count 160
Funding $25,537,838.3
PubMed Score 130.31
PubTator Score 199.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -3.400 0.000
osteosarcoma 1.544 0.000
cystic fibrosis 1.071 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.003
lung cancer -1.800 0.003
group 3 medulloblastoma -1.100 0.012
invasive ductal carcinoma -1.208 0.019
ductal carcinoma in situ 1.700 0.048
ovarian cancer -4.000 0.000
pituitary cancer -1.100 0.000

Synonym

Accession Q99801 O15465 Q9H2P4 Q9H2P5 Q9H2P6 Q9H2P7 Q9HBG0
Symbols NKX3
BAPX2
NKX3A
NKX3.1

Gene

PDB

2L9R  

 GO Component (2)

Gene RIF (74)

PMID Text
26841725 The androgen-regulated homeodomain transcription factor NKX3.1 plays roles in early prostate development and functions as a prostate-specific tumor suppressor.
26689514 the association between the down-regulation of PTEN and NKX3.1 genes contributed to prostate tumorigenesis.
26148677 An NKX3.1 binding site polymorphism in the l-plastin promoter leads to differential gene expression in human prostate cancer
25977336 Analysis of prostate cancer tissues showed that the presence of a TMPRSS2-ERG rearrangement was highly correlated with lower levels of NKX3.1 expression consistent with the role of NKX3.1 as a suppressor of the pathogenic gene rearrangement.
25777618 NKX3.1 and DYRK1B were shown to interact via the DYRK1B kinase domain. In vitro kinase assay showed that DYRK1B phosphorylated NKX3.1 at serine 185, a residue critical for NKX3.1 steady-state turnover.
25360740 NKX3.1 expression mediate beta-catenin and E-cadherin association and cell migration in prostate cells.
24996432 NKX3.1 labelling is limited to estrogen/progesterone/androgen receptor-positive breast carcinomas.
24894197 Our results indicate that variation in NKX3.1 expression combined with selenium or vitamin E treatment modifies the risk of prostate cancer.
24779299 Loci at 8q24 and 8q21 could influence susceptibility to prostate cancer in the northern Chinese population
24434284 Androgens and NKX3.1 expression regulate the progression of the cell cycle and concurrently activate the DNA damage response.
More...

AA Sequence

MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAG      1 - 70
AQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELE     71 - 140
RKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASL    141 - 210
VSVYNSYPYYPYLYCVGSWSPAFW                                                  211 - 234
//

Text Mined References (91)

PMID Year Title
26841725 2016 Regulating NKX3.1 stability and function: Post-translational modifications and structural determinants.
26689514 Concurrent Down-Regulation of PTEN and NKX3.1 Expression in Iranian Patients with Prostate Cancer.
26148677 2016 An NKX3.1 binding site polymorphism in the l-plastin promoter leads to differential gene expression in human prostate cancer.
25977336 2015 NKX3.1 Suppresses TMPRSS2-ERG Gene Rearrangement and Mediates Repair of Androgen Receptor-Induced DNA Damage.
25777618 2015 The Tumor Suppressor NKX3.1 Is Targeted for Degradation by DYRK1B Kinase.
25360740 2014 TNF?-mediated loss of ?-catenin/E-cadherin association and subsequent increase in cell migration is partially restored by NKX3.1 expression in prostate cells.
24996432 2014 NKX3.1 is expressed in ER-positive and AR-positive primary breast carcinomas.
24894197 2014 A functional variant in NKX3.1 associated with prostate cancer risk in the Selenium and Vitamin E Cancer Prevention Trial (SELECT).
24779299 2014 Study of genetic variants of 8q21 and 8q24 associated with prostate cancer in Jing-Jin residents in northern China.
24434284 2014 DNA damage response (DDR) via NKX3.1 expression in prostate cells.
More...