Property Summary

NCBI Gene PubMed Count 38
PubMed Score 145.17
PubTator Score 126.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Liver carcinoma 217
Disease Target Count P-value
pediatric high grade glioma 2712 5.48527515168048E-6
ovarian cancer 8492 6.88776213880499E-6
psoriasis 6685 1.74641700054853E-5
atypical teratoid/rhabdoid tumor 1095 6.49724709146006E-5
glioblastoma 5572 6.9454537675611E-5
Multiple myeloma 1328 0.0024807932641696
non primary Sjogren syndrome sicca 840 0.0295108630060436
Disease Target Count Z-score Confidence
Neurodegenerative disease 383 0.0 4.0

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.074 0.002
psoriasis 2.200 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
glioblastoma -1.300 0.000
pediatric high grade glioma -1.200 0.000
non primary Sjogren syndrome sicca 1.200 0.030
ovarian cancer 2.000 0.000

Synonym

Accession Q99798 O75809 Q5JZ41 Q6FHX0 Q8TAQ6 Aconitase
Symbols ICRD
OCA8
OPA9
ACONM
HEL-S-284

Gene

PANTHER Protein Class (2)

  Ortholog (16)

Gene RIF (16)

PMID Text
25351951 Our study shows that autosomal recessive ACO2 mutations can cause either isolated or syndromic optic neuropathy.
25322927 Results suggest that ACO2 activity is reduced in peripheral lymphocytes of subjects with Alzheimer's disease and mild cognitive impairment and correlates with antioxidant protection
24785945 immunofluorescence staining localized ACO2 to the human sperm mid-piece. By immunoblotting, we demonstrated that the level of ACO2 protein in asthenozoospermic samples was significantly decreased compared with that in normal fertile men
24429287 Ogg1 chaperoning of Aco-2 in preventing oxidant-mediated mtDNA damage and apoptosis may afford an innovative target for the molecular events underlying oxidant-induced toxicity.
23709747 Hypoxia upregulates the gene expression of mitochondrial aconitase in prostate carcinoma cells
23550275 Gastric cancer patients with lower ACO2 expression have a shorter survival time than those with higher ACO2 expression.
22405087 Homozygosity mapping followed by whole-exome sequencing disclosed a Ser112Arg mutation in ACO2.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20607720 these results suggest that p53 downregulation of mACON gene expression in human prostate carcinoma cells may not occur through the putative consensus p53 response elements found within the mACON promoter.
19524665 abolishes oxidant-induced apoptosis
More...

AA Sequence

MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIV      1 - 70
YGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDL     71 - 140
RRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGG    141 - 210
ADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGM    211 - 280
ATICNMGAEIGATTSVFPYNHRMKKYLSKTGREDIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHIN    281 - 350
GPFTPDLAHPVAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS    351 - 420
EQIRATIERDGYAQILRDLGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFV    421 - 490
TSPEIVTALAIAGTLKFNPETDYLTGTDGKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSP    491 - 560
TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKAN    561 - 630
SVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLK    631 - 700
KQGLLPLTFADPADYNKIHPVDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGS    701 - 770
ALNRMKELQQ                                                                771 - 780
//

Text Mined References (44)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25351951 2014 Mutations in the tricarboxylic acid cycle enzyme, aconitase 2, cause either isolated or syndromic optic neuropathy with encephalopathy and cerebellar atrophy.
25322927 2015 Lymphocytic mitochondrial aconitase activity is reduced in Alzheimer's disease and mild cognitive impairment.
24785945 2014 The role of mitochondrial aconitate (ACO2) in human sperm motility.
24429287 2014 Mitochondria-targeted Ogg1 and aconitase-2 prevent oxidant-induced mitochondrial DNA damage in alveolar epithelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23709747 2013 Hypoxia upregulates the gene expression of mitochondrial aconitase in prostate carcinoma cells.
23550275 2013 Decreased expression of the mitochondrial metabolic enzyme aconitase (ACO2) is associated with poor prognosis in gastric cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22405087 2012 Infantile cerebellar-retinal degeneration associated with a mutation in mitochondrial aconitase, ACO2.
More...