Property Summary

NCBI Gene PubMed Count 21
PubMed Score 56.92
PubTator Score 100.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Botulism 24 4.301 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer -1.500 4.9e-02
intraductal papillary-mucinous carcinoma... 1.900 8.1e-03
lung adenocarcinoma -1.100 8.0e-13
lung carcinoma -1.200 1.2e-06
non-small cell lung cancer -1.664 2.0e-18
psoriasis 1.200 2.4e-04

Gene RIF (14)

AA Sequence

MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVV      1 - 70
IWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVP     71 - 140
PSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYI    141 - 210
CTSSNEEGTQFCNITVAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREA    211 - 280
YEEPPEQLRELSREREEEDDYRQEEQRSTGRESPDHLDQ                                   281 - 319
//

Text Mined References (23)

PMID Year Title