Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
Funding $506,401.75
PubMed Score 75.90
PubTator Score 100.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.200 0.000
non-small cell lung cancer -1.664 0.000
intraductal papillary-mucinous carcinoma... 1.900 0.008
colon cancer -1.500 0.049
lung adenocarcinoma -1.900 0.000
lung carcinoma -1.200 0.000

Synonym

Accession Q99795 Q5VZP6
Symbols A33

Gene

 Grant Application (2)

Gene RIF (12)

PMID Text
23898208 HIV-1 Tat downregulates the expression of glycoprotein A33 (GPA33) in human primary T cells
23294608 Data indicate positive staining was observed for both A33 expression and KRN330 binding from patients biopsied on Day 8, 9 or 14 following initial dosing of 3 mg/kg.
23230278 Data indicate that EpCAM- and A33-Exos were released from the apical and basolateral surfaces, respectively.
22623782 Increased interaction between vaccinia virus proteins A33 and B5 is detrimental to infectious extracellular enveloped virion production.
22623777 The A33-dependent incorporation of B5 into extracellular enveloped vaccinia virions is mediated through an interaction between their lumenal domains.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of glycoprotein A33, transmembrane (GPA33) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19064610 Observational study of gene-disease association. (HuGE Navigator)
18236042 This work has demonstrated that the antigen is both highly immobile and extremely persistent-retaining its surface localization for a turnover halflife of greater than 2 days.
More...

AA Sequence

MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVV      1 - 70
IWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVP     71 - 140
PSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYI    141 - 210
CTSSNEEGTQFCNITVAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREA    211 - 280
YEEPPEQLRELSREREEEDDYRQEEQRSTGRESPDHLDQ                                   281 - 319
//

Text Mined References (22)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23294608 2013 Safety, pharmacokinetics and pharmacodynamics of the anti-A33 fully-human monoclonal antibody, KRN330, in patients with advanced colorectal cancer.
23230278 2013 Two distinct populations of exosomes are released from LIM1863 colon carcinoma cell-derived organoids.
22623782 2012 Increased interaction between vaccinia virus proteins A33 and B5 is detrimental to infectious extracellular enveloped virion production.
22623777 2012 The A33-dependent incorporation of B5 into extracellular enveloped vaccinia virions is mediated through an interaction between their lumenal domains.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18236042 2008 A33 antigen displays persistent surface expression.
More...