Property Summary

NCBI Gene PubMed Count 52
PubMed Score 164.16
PubTator Score 48.64

Knowledge Summary

Patent (25,942)

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.058 5.0e-05
cutaneous lupus erythematosus 1.100 1.6e-02
interstitial cystitis 1.700 3.7e-04
lung adenocarcinoma -2.100 1.6e-09
lung carcinoma -1.600 3.0e-15
sonic hedgehog group medulloblastoma 1.200 8.3e-04

 CSPA Cell Line (1)

Gene RIF (40)

AA Sequence

MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMK      1 - 70
KTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTIISSDRCIS     71 - 140
VLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDTANLHGKISCFNNFSLSTPGSSSWPTHSQMD    141 - 210
PVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLN    211 - 280
LLELHHTAMPGSVFSLGLPLATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSH    281 - 350
RSFTKMSSMNERTSMNERETGML                                                   351 - 373
//

Text Mined References (57)

PMID Year Title