Property Summary

NCBI Gene PubMed Count 44
Grant Count 32
R01 Count 19
Funding $1,873,917.01
PubMed Score 115.99
PubTator Score 48.64

Knowledge Summary

Patent (25,942)

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 0.016
adrenocortical carcinoma -1.058 0.000
interstitial cystitis 1.700 0.000
sonic hedgehog group medulloblastoma 1.200 0.001
lung adenocarcinoma -2.100 0.000
lung carcinoma -1.600 0.000

Gene RIF (32)

PMID Text
25637017 ChemR23, the receptor for chemerin and resolvin E1, is expressed and functional on M1 but not on M2 macrophages.
25627894 Gestational obesity and gestational diabetes mellitus may contribute to elevated serum chemerin. Serum chemerin in pregnancy was associated with insulin resistance and triglycerides. Chemerin gene may play a role both in obese and gestational diabetes mellitus patients
25539827 Increased chemerin expression in dermal blood vessels may be associated with the development of digital ulcers in systemic sclerosis.
25121101 The study for the first time confirmed a marked expression of chemerin and CMKLR1 in the liver of chronic hepatitis patients.
25079809 Results indicate that Abeta42 activates CMKLR1, leading to glia cell migration and clearance of Abeta42; and is involved in Abeta processing and clearance
25030943 The effects of diclofenac on the incidence of pancreatitis following endoscopic retrograde cholangiopancreatography via lipoxin A4 and resolvin D1 and E1 levels is reported.
24779513 Results lend some support to a presumable role of locally produced chemerin in the progression of atherosclerotic lesions, possibly acting through its CMKLR1 receptor.
24689495 This study identified the up-regulation of ChemR23 in post-traumatic injury of calcaneal articular fracture
24659779 Development of a membrane-anchored chemerin receptor agonist as a novel modulator of allergic airway inflammation and neuropathic pain.
23999103 ChemR23 is expressed in neutrophil granules and rapidly upregulated upon neutrophil activation.
More...

AA Sequence

MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMK      1 - 70
KTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTIISSDRCIS     71 - 140
VLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDTANLHGKISCFNNFSLSTPGSSSWPTHSQMD    141 - 210
PVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLN    211 - 280
LLELHHTAMPGSVFSLGLPLATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSH    281 - 350
RSFTKMSSMNERTSMNERETGML                                                   351 - 373
//

Text Mined References (49)

PMID Year Title
25637017 2015 ChemR23, the receptor for chemerin and resolvin E1, is expressed and functional on M1 but not on M2 macrophages.
25627894 2015 Chemerin expression in Chinese pregnant women with and without gestational diabetes mellitus.
25539827 2015 Increased expression of chemerin in endothelial cells due to Fli1 deficiency may contribute to the development of digital ulcers in systemic sclerosis.
25121101 2014 Hepatic chemerin and chemokine-like receptor 1 expression in patients with chronic hepatitis C.
25079809 2015 The chemerin receptor CMKLR1 is a functional receptor for amyloid-? peptide.
25030943 2014 Effect of diclofenac on the levels of lipoxin A4 and Resolvin D1 and E1 in the post-ERCP pancreatitis.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24779513 2014 Chemerin and CMKLR1 expression in human arteries and periadventitial fat: a possible role for local chemerin in atherosclerosis?
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24689495 2014 Up-regulation of the chemo-attractive receptor ChemR23 and occurrence of apoptosis in human chondrocytes isolated from fractured calcaneal osteochondral fragments.
More...