Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.29
PubTator Score 11.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (29)

Disease log2 FC p
adult high grade glioma -3.000 8.2e-05
astrocytic glioma -2.900 2.4e-03
Astrocytoma, Pilocytic -2.800 1.3e-07
atypical teratoid / rhabdoid tumor -5.100 1.5e-08
colon cancer -2.300 2.0e-03
cutaneous lupus erythematosus -1.300 1.1e-02
ductal carcinoma in situ -1.200 1.3e-02
Endometriosis 1.817 3.4e-02
ependymoma -3.900 9.4e-03
glioblastoma -2.800 4.0e-06
group 3 medulloblastoma -1.900 2.9e-02
interstitial cystitis 1.200 1.0e-02
interstitial lung disease 1.300 2.5e-02
intraductal papillary-mucinous adenoma (... -1.300 2.2e-04
intraductal papillary-mucinous carcinoma... -1.600 2.4e-02
intraductal papillary-mucinous neoplasm ... -1.100 7.3e-03
invasive ductal carcinoma -1.218 2.0e-03
lung cancer -1.100 1.4e-02
medulloblastoma, large-cell -2.600 1.4e-03
oligodendroglioma -1.800 1.8e-02
osteosarcoma 1.729 7.9e-09
Pick disease -1.200 8.0e-03
pituitary cancer -1.100 1.1e-05
primitive neuroectodermal tumor -3.200 1.1e-04
psoriasis 1.400 6.3e-03
Rheumatoid arthritis -1.800 5.3e-03
spina bifida -1.388 3.8e-02
subependymal giant cell astrocytoma -3.596 4.0e-02
ulcerative colitis 1.400 1.1e-04

Gene RIF (6)

AA Sequence

MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTGVLPTNPEESWQVYSSAQDSE      1 - 70
GRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVE     71 - 140
ESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEEIGAYDYDELQSR    141 - 210
VSNLEERLRACMQKLACGKLTGISDPVTVKTSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSM    211 - 280
VDFMNTDNFTSHRLPHPWSGTGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWG    281 - 350
GHSDIDLMVDESGLWAVYATNQNAGNIVVSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNGYSG    351 - 420
GTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLFHVIRSDEL         421 - 485
//

Text Mined References (20)

PMID Year Title