Property Summary

NCBI Gene PubMed Count 16
Grant Count 86
R01 Count 31
Funding $11,162,598.16
PubMed Score 24.69
PubTator Score 11.65

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99784 Q53XZ8 Q6IMJ4 Q6IMJ5 Q8N8R0 Q969S7 Q99452
Symbols AMY
NOE1
OlfA
NOELIN1

Gene

PANTHER Protein Class (1)

PDB

4XAT  

Gene RIF (5)

PMID Text
26377223 human chorionic gonadotropin stimulated miR-212, which down-regulated OLFM1 and CTBP1 expression in fallopian and endometrial epithelial cells to favor spheroid attachment
26121352 OLF domains from H. sapiens olfactomedin-1 and M. musculus gliomedin were biophysically, biochemically, and structurally characterized.
25999259 Down-regulation of OLFM1 in fallopian tube epithelial cells enhances spheroid attachment to fallopian tube.
21968811 Wnt activation suppresses Olfm-1 expression, and this may predispose a favorable microenvironment of the retained embryo in the Fallopian tube, leading to ectopic pregnancy in humans
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTGVLPTNPEESWQVYSSAQDSE      1 - 70
GRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVE     71 - 140
ESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEEIGAYDYDELQSR    141 - 210
VSNLEERLRACMQKLACGKLTGISDPVTVKTSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSM    211 - 280
VDFMNTDNFTSHRLPHPWSGTGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWG    281 - 350
GHSDIDLMVDESGLWAVYATNQNAGNIVVSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNGYSG    351 - 420
GTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLFHVIRSDEL         421 - 485
//

Text Mined References (19)

PMID Year Title
26377223 2015 MicroRNA-212 Regulates the Expression of Olfactomedin 1 and C-Terminal Binding Protein 1 in Human Endometrial Epithelial Cells to Enhance Spheroid Attachment In Vitro.
26121352 2015 Molecular Details of Olfactomedin Domains Provide Pathway to Structure-Function Studies.
25999259 2015 Human chorionic gonadotropin stimulates spheroid attachment on fallopian tube epithelial cells through the mitogen-activated protein kinase pathway and down-regulation of olfactomedin-1.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22095909 2012 Serum ferritin levels are associated with a distinct phenotype of chronic hepatitis C poorly responding to pegylated interferon-alpha and ribavirin therapy.
21968811 2012 Wnt activation downregulates olfactomedin-1 in Fallopian tubal epithelial cells: a microenvironment predisposed to tubal ectopic pregnancy.
21228389 2011 Olfactomedin 2: expression in the eye and interaction with other olfactomedin domain-containing proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...