Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.58
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.1e-03
psoriasis 6685 1.5e-03
lung cancer 4473 3.4e-02

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 1.5e-03
osteosarcoma -1.466 1.1e-03
lung cancer 1.400 3.4e-02

 IMPC Phenotype (1)

 MGI Phenotype (1)

Gene RIF (2)

PMID Text
26385595 The study is the first to show that ATP5S is one of the target genes of miR-34a.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWL      1 - 70
LRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDD     71 - 140
CLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLEL    141 - 210
KLQLK                                                                     211 - 215
//

Text Mined References (21)

PMID Year Title
26385595 2015 MiR-34a is Involved in the Decrease of ATP Contents Induced by Resistin Through Target on ATP5S in HepG2 Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12745923 Understanding ATP synthesis: structure and mechanism of the F1-ATPase (Review).
12628343 2003 Rotary protein motors.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471886 2000 F1-ATPase: a highly efficient rotary ATP machine.
11744738 2002 Factor B and the mitochondrial ATP synthase complex.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9461222 1998 Energy transduction in ATP synthase.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
6143319 1984 Evidence for the involvement of coupling factor B in the H+ channel of the mitochondrial H+-ATPase.