Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.58
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 0.002
osteosarcoma -1.466 0.001
lung cancer 1.400 0.034

Synonym

Accession Q99766 A8K1U3 D9N156 Q8WWX3 Q96F77
Symbols FB
ATPW
HSU79253

Gene

Gene RIF (2)

PMID Text
26385595 The study is the first to show that ATP5S is one of the target genes of miR-34a.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWL      1 - 70
LRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDD     71 - 140
CLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLEL    141 - 210
KLQLK                                                                     211 - 215
//

Text Mined References (21)

PMID Year Title
26385595 2015 MiR-34a is Involved in the Decrease of ATP Contents Induced by Resistin Through Target on ATP5S in HepG2 Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...