Property Summary

Ligand Count 1
NCBI Gene PubMed Count 62
PubMed Score 54.71
PubTator Score 47.67

Knowledge Summary

Patent (7,681)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Esophageal Neoplasms 69 0.0 0.0
Disease Target Count P-value
non-small cell lung cancer 2890 1.0e-27
ovarian cancer 8519 3.5e-08
osteosarcoma 7950 9.6e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Hemangioma 69 3.913 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer -1.190 1.0e-27
osteosarcoma -1.968 9.6e-07
ovarian cancer -1.100 3.5e-08

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (33)

AA Sequence

MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVE      1 - 70
HKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQV     71 - 140
RIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSE    141 - 210
QCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYH    211 - 280
VSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERN    281 - 350
VPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ    351 - 420
HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDI    421 - 490
KGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEM    491 - 560
LTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHFAQLMY        561 - 626
//

Text Mined References (71)

PMID Year Title