Property Summary

NCBI Gene PubMed Count 34
Grant Count 34
R01 Count 19
Funding $2,649,736.51
PubMed Score 119.35
PubTator Score 69.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Gene RIF (28)

PMID Text
26041303 Thioredoxin 2 Is a Novel E2-Interacting Protein That Inhibits the Replication of Classical Swine Fever Virus by promoting the nuclear translocation of the p65 subunit of NF-kappaB.
24735978 CERKL interacts with TRX2 and plays a novel key role in the regulation of the TRX2 antioxidant pathway.
24342608 TGF-beta-mediated expression of the epithelial-mesenchymal transition marker fibronectin was inhibited not only by chemicals that interfere with reactive oxygen species signaling but also by exogenously expressed mitochondrial thioredoxin.
24295294 The Grx2 system could help to keep Trx2/1 reduced during an oxidative stress, thereby contributing to the anti-apoptotic signaling.
23485938 We showed that overexpression of TRXs reduced cell death; TRX2 was expressed in the mitochondria, while TRX1 was expressed in the cytoplasm.
21557999 knockdown of TRX-1 or TRX-2 sensitizes cells to CYP2E1-induced oxidant stress partially via ASK-1 and JNK1 signaling pathways. Both TRX-1 and TRX-2 are important for defense against CYP2E1-induced oxidative stress.
21327297 Data show that knockdown of S100P led to downregulation of thioredoxin 1 and beta-tubulin and upregulation of RhoGDIA, all potential therapeutic targets in cancer.
21158569 TRX1 and TRX2 regulate the proliferation and survival of adipocyte derived stem cells; these processes are mediated by the activation of ERK1/2
20929858 Both thioredoxin 2 and glutaredoxin 2 contribute to the reduction of the mitochondrial 2-Cys peroxiredoxin Prx3.
20877624 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDF      1 - 70
QDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMK     71 - 140
NGDVVDKFVGIKDEDQLEAFLKKLIG                                                141 - 166
//

Text Mined References (40)

PMID Year Title
26626369 2016 Human thioredoxin 2 deficiency impairs mitochondrial redox homeostasis and causes early-onset neurodegeneration.
26041303 2015 Thioredoxin 2 Is a Novel E2-Interacting Protein That Inhibits the Replication of Classical Swine Fever Virus.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24735978 2014 CERKL interacts with mitochondrial TRX2 and protects retinal cells from oxidative stress-induced apoptosis.
24342608 2014 A mitochondrial thioredoxin-sensitive mechanism regulates TGF-?-mediated gene expression associated with epithelial-mesenchymal transition.
24295294 2014 Glutaredoxin 2 reduces both thioredoxin 2 and thioredoxin 1 and protects cells from apoptosis induced by auranofin and 4-hydroxynonenal.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23485938 2013 Different anti-oxidant effects of thioredoxin 1 and thioredoxin 2 in retinal epithelial cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...