Property Summary

NCBI Gene PubMed Count 27
PubMed Score 4.98
PubTator Score 15.73

Knowledge Summary

Patent (1,176)

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 2.541 0.000
medulloblastoma, large-cell 1.200 0.000

Synonym

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gary Johnson 233 Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26157143 PIP5K1A modulates ribosomal RNA gene silencing through its interaction with histone H3 lysine 9 trimethylation and heterochromatin protein HP1-alpha.
23994136 PIP5K1A is modified by polySUMO-2 only during apoptosis.
23589613 CD28 regulates phosphatidylinositol 4,5-biphosphate turnover by recruiting and activating phosphatidylinositol 4-phosphate 5-kinases alpha in human primary CD4(+) T lymphocytes.
20660631 Results define the role of PIPKI-alpha in cell migration and describes a new mechanism for the spatial regulation of Rac1 activity that is critical for cell migration.
20426790 Localized production of Phosphatidylinositol 4,5-bisphosphate by PIP5K1A is required for invadopodia formation by breast cancer cells.
19331818 The data suggest that activation of FcgammaRIIA leads to membrane rafts coalescing into signaling platforms containing PIP5-kinase Ialpha and PI(4,5)P(2).
19158393 Extracellular calcium (Cao) stimulated PIP5K1alpha recruitment to the E-cadherin-catenin complex in the plasma membrane.
18981107 PI4P5-K Ialpha-mediated PIP(2) production is crucial for HIV-1 entry and the early steps of infection in permissive lymphocytes.
18981107 HIV-1 Env-gp120 protein induces PIP(2) production in permissive lymphocytes through the activation of phosphatidylinositol-4-phosphate 5-kinase (PI4P5-K) Ialpha. Cells overexpressing mutant D227A (D/A)-PI4P5-K Ialpha severely reduce HIV-1 infection
18534983 beta-arrestins direct the localization of PIP5K Ialpha and PIP(2) production to agonist-activated 7TMRs, thereby regulating receptor internalization
More...

AA Sequence

MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMPIKKIGHRSVD      1 - 70
SSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFK     71 - 140
TYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPG    141 - 210
YYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPT    211 - 280
FKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDT    281 - 350
RRPAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWK    351 - 420
ALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGE    421 - 490
HKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVAESEF    491 - 560
TH                                                                        561 - 562
//

Publication (31)

PMID Year Title
26157143 2015 Phosphatidylinositol-4-phosphate 5-Kinase 1? Modulates Ribosomal RNA Gene Silencing through Its Interaction with Histone H3 Lysine 9 Trimethylation and Heterochromatin Protein HP1-?.
23994136 2013 Nuclear pool of phosphatidylinositol 4 phosphate 5 kinase 1? is modified by polySUMO-2 during apoptosis.
23589613 2013 Phosphatidylinositol 4-phosphate 5-kinase ? activation critically contributes to CD28-dependent signaling responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20660631 2010 Type I PIPK-alpha regulates directed cell migration by modulating Rac1 plasma membrane targeting and activation.
20426790 2010 Phosphatidylinositol 4,5-bisphosphate and PIP5-kinase Ialpha are required for invadopodia formation in human breast cancer cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19889969 2009 PIP5K-driven PtdIns(4,5)P2 synthesis: regulation and cellular functions.
More...