Property Summary

NCBI Gene PubMed Count 27
PubMed Score 4.98
PubTator Score 15.73

Knowledge Summary

Patent (1,176)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.93829301446637E-6
medulloblastoma, large-cell 6234 1.88426075747352E-4

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 2.541 0.000
medulloblastoma, large-cell 1.200 0.000

Synonym

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
C. elegans OMA EggNOG

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26157143 PIP5K1A modulates ribosomal RNA gene silencing through its interaction with histone H3 lysine 9 trimethylation and heterochromatin protein HP1-alpha.
23994136 PIP5K1A is modified by polySUMO-2 only during apoptosis.
23589613 CD28 regulates phosphatidylinositol 4,5-biphosphate turnover by recruiting and activating phosphatidylinositol 4-phosphate 5-kinases alpha in human primary CD4(+) T lymphocytes.
20660631 Results define the role of PIPKI-alpha in cell migration and describes a new mechanism for the spatial regulation of Rac1 activity that is critical for cell migration.
20426790 Localized production of Phosphatidylinositol 4,5-bisphosphate by PIP5K1A is required for invadopodia formation by breast cancer cells.
19331818 The data suggest that activation of FcgammaRIIA leads to membrane rafts coalescing into signaling platforms containing PIP5-kinase Ialpha and PI(4,5)P(2).
19158393 Extracellular calcium (Cao) stimulated PIP5K1alpha recruitment to the E-cadherin-catenin complex in the plasma membrane.
18981107 PI4P5-K Ialpha-mediated PIP(2) production is crucial for HIV-1 entry and the early steps of infection in permissive lymphocytes.
18981107 HIV-1 Env-gp120 protein induces PIP(2) production in permissive lymphocytes through the activation of phosphatidylinositol-4-phosphate 5-kinase (PI4P5-K) Ialpha. Cells overexpressing mutant D227A (D/A)-PI4P5-K Ialpha severely reduce HIV-1 infection
18534983 beta-arrestins direct the localization of PIP5K Ialpha and PIP(2) production to agonist-activated 7TMRs, thereby regulating receptor internalization
More...

AA Sequence

MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMPIKKIGHRSVD      1 - 70
SSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFK     71 - 140
TYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPG    141 - 210
YYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPT    211 - 280
FKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDT    281 - 350
RRPAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWK    351 - 420
ALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGE    421 - 490
HKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVAESEF    491 - 560
TH                                                                        561 - 562
//

Text Mined References (31)

PMID Year Title
26157143 2015 Phosphatidylinositol-4-phosphate 5-Kinase 1? Modulates Ribosomal RNA Gene Silencing through Its Interaction with Histone H3 Lysine 9 Trimethylation and Heterochromatin Protein HP1-?.
23994136 2013 Nuclear pool of phosphatidylinositol 4 phosphate 5 kinase 1? is modified by polySUMO-2 during apoptosis.
23589613 2013 Phosphatidylinositol 4-phosphate 5-kinase ? activation critically contributes to CD28-dependent signaling responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20660631 2010 Type I PIPK-alpha regulates directed cell migration by modulating Rac1 plasma membrane targeting and activation.
20426790 2010 Phosphatidylinositol 4,5-bisphosphate and PIP5-kinase Ialpha are required for invadopodia formation in human breast cancer cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19889969 2009 PIP5K-driven PtdIns(4,5)P2 synthesis: regulation and cellular functions.
More...