Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
R01 Count 3
Funding $625,237
PubMed Score 44.17
PubTator Score 30.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 0.028
pilocytic astrocytoma 1.200 0.000
psoriasis 1.700 0.000

Gene RIF (6)

PMID Text
22632162 HIV-1 Tat 47-59 peptide downregulates gene expression of MyoD family inhibitor (MDFI) in U-937 macrophages
21664411 I-mfa domain proteins may be involved in their oncogenic functions by negatively regulating their transcriptional activities.
17289077 HIV-1 Tat 47-59 peptide downregulates gene expression of MyoD family inhibitor (MDFI) in U-937 macrophages
17289077 HIV-1 Tat 47-59 peptide downregulates gene expression of MyoD family inhibitor (MDFI) in U-937 macrophages
15207726 These results suggest that the physical and functional interaction between Zic and I-mfa proteins can play a role in the vertebrate development.
14530267 I-mfa functions as a molecular switch to suppress the store dependence of TRPC1

AA Sequence

MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATPMPQGNGPGIP      1 - 70
QGLDSTDLDVPTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGALGGPKAHRKLQTHPSLASQG     71 - 140
SKKSKSSSKSTTSQIPLQAQEDCCVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCLCCCCCGSGECA    141 - 210
DCDLPCDLDCGILDACCESADCLEICMECCGLCFSS                                      211 - 246
//

Text Mined References (21)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21664411 2011 I-mfa domain proteins specifically interact with SERTA domain proteins and repress their transactivating functions.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19060904 2009 An empirical framework for binary interactome mapping.
17289077 2007 Developmental regulators containing the I-mfa domain interact with T cyclins and Tat and modulate transcription.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...