Property Summary

NCBI Gene PubMed Count 25
PubMed Score 47.94
PubTator Score 30.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.1e-54
Astrocytoma, Pilocytic 3081 2.3e-04
cutaneous lupus erythematosus 1057 2.8e-02
Disease Target Count Z-score Confidence
Mycosis fungoides 29 3.573 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.3e-04
cutaneous lupus erythematosus 1.200 2.8e-02
psoriasis 1.700 3.1e-54

Synonym

Accession Q99750
Symbols I-MF
I-mfa

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATPMPQGNGPGIP      1 - 70
QGLDSTDLDVPTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGALGGPKAHRKLQTHPSLASQG     71 - 140
SKKSKSSSKSTTSQIPLQAQEDCCVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCLCCCCCGSGECA    141 - 210
DCDLPCDLDCGILDACCESADCLEICMECCGLCFSS                                      211 - 246
//

Text Mined References (25)

PMID Year Title