Property Summary

NCBI Gene PubMed Count 23
Grant Count 107
R01 Count 74
Funding $7,092,546.16
PubMed Score 157.54
PubTator Score 87.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99748 B2RPE8
Symbols NTN

Gene

Gene RIF (13)

PMID Text
24139947 In the cochlea, NTN immunostaining was found in the supporting cells of organ of Corti, including Deiters' cells, Hensen cells as well as Claudius' cells. In the spiral ganglia, NTN was seen in both the cell bodies and the nerve fibers of neurons.
24067900 Neurturin contributes toward an aggressive cancer cell phenotype, neuropathic pain and neuronal plasticity in pancreatic cancer.
22847529 Human neurturin protected crayfish neurons and glia from photodynamic injury.
21723942 Cyclic AMP signalling through PKA but not Epac is essential for neurturin-induced biphasic ERK1/2 activation and neurite outgrowths through GFRalpha2 isoforms.
18970938 No differences were found in the allelic frequencies of the variants or in the haplotype distribution between Hirschsprung's disease patients & controls, nor to any demographic/clinical parameters within the group of patients.
18970938 Observational study of gene-disease association. (HuGE Navigator)
18222320 GDNF, NTN, GFRalpha-1, GFRalpha-2, and c-Ret proteins are differentially expressed in the different stages of hair follicle cycle. GFRalpha-mediated signaling involves c-Ret and may play a role in human HF biology.
17522305 Depending on the brain's expressions of specific GDNF family GFRalpha2 receptor spliced isoforms, neurturin may promote or inhibit neurite outgrowth through the multicomponent receptor complex.
16895582 GDNF and NTN differentially regulate the expression of distinct miRNA precursors through the activation of mitogen-activated protein kinase
16081799 Addition of neurturin to activated peripheral blood mononuclear leukocytes reduces the amount of detectable tumor necrosis factor protein without altering its transcription.
More...

AA Sequence

MQRWKAAALASVLCSSVLSIWMCREGLLLSHRLGPALVPLHRLPRTLDARIARLAQYRALLQGAPDAMEL      1 - 70
RELTPWAGRPPGPRRRAGPRRRRARARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARV     71 - 140
YDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV                 141 - 197
//

Text Mined References (24)

PMID Year Title
24139947 2014 Immunohistological analysis of neurturin and its receptors in human cochlea.
24067900 2014 The neurotrophic factor neurturin contributes toward an aggressive cancer cell phenotype, neuropathic pain and neuronal plasticity in pancreatic cancer.
22847529 2013 Protection effect of GDNF and neurturin on photosensitized crayfish neurons and glial cells.
21723942 2011 Cyclic AMP signalling through PKA but not Epac is essential for neurturin-induced biphasic ERK1/2 activation and neurite outgrowths through GFR?2 isoforms.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
18970938 2008 Polymorphisms in the genes encoding the 4 RET ligands, GDNF, NTN, ARTN, PSPN, and susceptibility to Hirschsprung disease.
18222320 2008 Expression patterns of the glial cell line-derived neurotrophic factor, neurturin, their cognate receptors GFRalpha-1, GFRalpha-2, and a common signal transduction element c-Ret in the human skin hair follicles.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17522305 2007 Glial cell line-derived neurotrophic factor and neurturin inhibit neurite outgrowth and activate RhoA through GFR alpha 2b, an alternatively spliced isoform of GFR alpha 2.
16895582 2006 Glial cell-line derived neurotrophic factor and neurturin regulate the expressions of distinct miRNA precursors through the activation of GFRalpha2.
More...