Property Summary

NCBI Gene PubMed Count 23
PubMed Score 170.41
PubTator Score 87.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (13)

AA Sequence

MQRWKAAALASVLCSSVLSIWMCREGLLLSHRLGPALVPLHRLPRTLDARIARLAQYRALLQGAPDAMEL      1 - 70
RELTPWAGRPPGPRRRAGPRRRRARARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARV     71 - 140
YDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV                 141 - 197
//

Text Mined References (24)

PMID Year Title