Property Summary

NCBI Gene PubMed Count 26
PubMed Score 44.74
PubTator Score 33.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.300 1.5e-02
ependymoma -1.100 3.4e-02
glioblastoma -1.500 3.8e-06
medulloblastoma -1.500 7.0e-06
atypical teratoid / rhabdoid tumor -2.100 1.9e-05
medulloblastoma, large-cell -2.100 1.2e-04
intraductal papillary-mucinous adenoma (... 1.300 2.7e-04
intraductal papillary-mucinous carcinoma... 1.300 2.2e-04
adult high grade glioma -1.400 4.5e-03
Alzheimer's disease -1.200 3.0e-02
Pick disease -1.400 1.5e-04
ovarian cancer 2.600 1.6e-06

Protein-protein Interaction (7)

Gene RIF (6)

PMID Text
22113424 study did not support NAPG as a susceptible gene for schizophrenia in the Chinese Han population
19429185 Our study supports NAPG as a candidate for susceptibility to bipolar disorder as several combinations of haplotype were found to be associated with bipolar disorder.
19429185 Observational study of gene-disease association. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
16395123 Observational study of gene-disease association. (HuGE Navigator)
12554740 The functional domains of this protein are mapped.

AA Sequence

MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRA      1 - 70
LFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQT     71 - 140
ANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDY    141 - 210
VAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGI    211 - 280
KKKSPATPQAKPDGVTATAADEEEDEYSGGLC                                          281 - 312
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22113424 2012 NAPG may not be a common risk gene shared by bipolar disorder and schizophrenia in Chinese population.
21866343 2012 The 18p11.22 locus is associated with never smoker non-small cell lung cancer susceptibility in Korean populations.
21269460 2011 Initial characterization of the human central proteome.
19429185 2009 Association study on the NAPG gene and bipolar disorder in the Chinese Han population.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
17897319 2007 Integral and associated lysosomal membrane proteins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16395123 2006 Analysis of variations in the NAPG gene on chromosome 18p11 in bipolar disorder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12554740 2003 Mapping of functional domains of gamma-SNAP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278501 2001 Gaf-1, a gamma -SNAP-binding protein associated with the mitochondria.
10683148 2000 Preferential association of syntaxin 8 with the early endosome.
9269766 1997 Regulated secretion in platelets: identification of elements of the platelet exocytosis machinery.
9165027 1997 Association of N-ethylmaleimide sensitive fusion (NSF) protein and soluble NSF attachment proteins-alpha and -gamma with glucose transporter-4-containing vesicles in primary rat adipocytes.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8455721 1993 SNAP family of NSF attachment proteins includes a brain-specific isoform.
1601890 1992 Soluble N-ethylmaleimide-sensitive fusion attachment proteins (SNAPs) bind to a multi-SNAP receptor complex in Golgi membranes.
1315316 1992 A multisubunit particle implicated in membrane fusion.