Property Summary

NCBI Gene PubMed Count 26
PubMed Score 44.74
PubTator Score 33.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.300 0.015
ependymoma -1.100 0.034
glioblastoma -1.500 0.000
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.100 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.000
intraductal papillary-mucinous carcinoma... 1.300 0.000
adult high grade glioma -1.400 0.005
Alzheimer's disease -1.200 0.030
Pick disease -1.400 0.000
ovarian cancer 2.600 0.000

Synonym

Accession Q99747 B4DFC9 Q9BUV1 SNAP-gamma
Symbols GAMMASNAP

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
22113424 study did not support NAPG as a susceptible gene for schizophrenia in the Chinese Han population
19429185 Our study supports NAPG as a candidate for susceptibility to bipolar disorder as several combinations of haplotype were found to be associated with bipolar disorder.
19429185 Observational study of gene-disease association. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
16395123 Observational study of gene-disease association. (HuGE Navigator)
12554740 The functional domains of this protein are mapped.

AA Sequence

MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRA      1 - 70
LFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQT     71 - 140
ANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDY    141 - 210
VAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGI    211 - 280
KKKSPATPQAKPDGVTATAADEEEDEYSGGLC                                          281 - 312
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22113424 2012 NAPG may not be a common risk gene shared by bipolar disorder and schizophrenia in Chinese population.
21866343 2012 The 18p11.22 locus is associated with never smoker non-small cell lung cancer susceptibility in Korean populations.
21269460 2011 Initial characterization of the human central proteome.
19429185 2009 Association study on the NAPG gene and bipolar disorder in the Chinese Han population.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...