Property Summary

NCBI Gene PubMed Count 56
PubMed Score 81.41
PubTator Score 60.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-03
astrocytic glioma -1.300 9.9e-03
atypical teratoid / rhabdoid tumor -1.600 5.5e-03
Breast cancer 2.200 4.0e-02
colon cancer 1.700 1.0e-04
ependymoma -1.100 1.4e-02
group 3 medulloblastoma -2.600 6.3e-05
interstitial cystitis -1.100 3.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 9.2e-03
lung carcinoma 2.300 7.5e-22
malignant mesothelioma -4.200 3.6e-08
medulloblastoma, large-cell -1.500 3.4e-05
oligodendroglioma -1.600 4.4e-03
osteosarcoma 1.424 2.7e-05
ovarian cancer 1.500 1.7e-04
pituitary cancer -1.700 1.5e-03
primitive neuroectodermal tumor -1.600 1.2e-02
psoriasis -1.400 6.3e-04
spina bifida -1.683 1.7e-02

Protein-protein Interaction (5)

Gene RIF (47)

AA Sequence

MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICD      1 - 70
IQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPSDVMDQNLLNFLPEQEHSE     71 - 140
VYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDN    141 - 210
TLSRPCRVPLGKEVCFIATVRLATPQFLKEMCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVL    211 - 280
GTSGYDYYHIDDLELLARCHQHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSV    281 - 350
VSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSH    351 - 420
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLLPQTVLQSTPA    421 - 490
PMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDSNVQMFLQQPAVSLSFSSTQR    491 - 560
PEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLLRESSVISTQGPKPMRSSQLMQSSGRSGSSL    561 - 630
VSPFSSATAALPPSLNLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTG    631 - 700
RQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTS    701 - 770
LHSEQQDSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR                    771 - 824
//

Text Mined References (59)

PMID Year Title