Property Summary

NCBI Gene PubMed Count 53
Grant Count 75
R01 Count 44
Funding $11,385,504.62
PubMed Score 73.85
PubTator Score 60.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -4.600 0.000
astrocytic glioma -2.200 0.002
ependymoma -1.800 0.003
oligodendroglioma -1.600 0.004
psoriasis -1.400 0.001
osteosarcoma 1.424 0.000
sonic hedgehog group medulloblastoma -2.800 0.001
atypical teratoid / rhabdoid tumor -1.900 0.008
medulloblastoma, large-cell -3.700 0.000
primitive neuroectodermal tumor -1.800 0.010
intraductal papillary-mucinous neoplasm ... 1.200 0.008
colon cancer 1.900 0.000
Breast cancer 2.200 0.040
interstitial cystitis -2.300 0.000
adult high grade glioma -1.100 0.001
lung carcinoma 2.300 0.000
spina bifida -1.683 0.017
ovarian cancer 1.500 0.000
pituitary cancer -1.800 0.001

Synonym

Accession Q99743 Q4ZFV9 Q53SQ3 Q86V96 Q99629 Neuronal PAS2
Symbols MOP4
PASD4
bHLHe9

Gene

Gene RIF (44)

PMID Text
26134245 CLOCK, ARNTL, and NPAS2 gene polymorphisms may have a role in seasonal variations in mood and behavior
25989161 Genetic variations in NPAS2 might be a biomarker for a seasonal pattern in bipolar disorders.
25956372 With whole-exome sequencing a novel mutation in NPAS2 was identified in a Turkish family with nonobstructive azoospermia.
25227809 NPAS2 rs2305160 polymorphism does not appear to have any association with risk of chronic lymphocytic leukemia in our Pakistani population.
24978311 NPAS2, functioned as a potential tumor suppressor gene, could serve as a promising target and potential prognostic indicator for colorectal cancer.
24919398 Two single nucleotide polymorphisms in RORA were associated with breast cancer in the whole sample and among postmenopausal women, and we also reported an association with CLOCK, RORA, and NPAS2 in the analyses at the gene level
24824748 distributions of allelic, genotypic, and haplotypic variants of NPAS2 (rs2305160 and rs6725296) were not significantly different between schizophrenic patients with and without RLS
24754267 Functional rs1053096 and rs2305160 polymorphisms in the NPAS2 gene are associated with overall survival in transcatheter arterial chemoembolization-treated hepatocellular carcinoma patients.
23449886 Variants in NPAS2 have been associated with seasonality and seasonal affective disorder, phenotypes that could reflect circadian rhythm disruption.
22538398 Genetic variants of NPAS2 associate with seasonal affective disorder or winter depression.
More...

AA Sequence

MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICD      1 - 70
IQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPSDVMDQNLLNFLPEQEHSE     71 - 140
VYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDN    141 - 210
TLSRPCRVPLGKEVCFIATVRLATPQFLKEMCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVL    211 - 280
GTSGYDYYHIDDLELLARCHQHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSV    281 - 350
VSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSH    351 - 420
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLLPQTVLQSTPA    421 - 490
PMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDSNVQMFLQQPAVSLSFSSTQR    491 - 560
PEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLLRESSVISTQGPKPMRSSQLMQSSGRSGSSL    561 - 630
VSPFSSATAALPPSLNLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTG    631 - 700
RQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTS    701 - 770
LHSEQQDSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR                    771 - 824
//

Text Mined References (56)

PMID Year Title
26134245 2015 Association of CLOCK, ARNTL, and NPAS2 gene polymorphisms and seasonal variations in mood and behavior.
25989161 2015 Genetic association study of circadian genes with seasonal pattern in bipolar disorders.
25956372 2015 Whole-exome sequencing identifies novel homozygous mutation in NPAS2 in family with nonobstructive azoospermia.
25227809 2014 Lack of association of the NPAS2 gene Ala394Thr polymorphism (rs2305160:G>A) with risk of chronic lymphocytic leukemia.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24978311 2014 Silencing NPAS2 promotes cell growth and invasion in DLD-1 cells and correlated with poor prognosis of colorectal cancer.
24919398 2014 Breast cancer risk, nightwork, and circadian clock gene polymorphisms.
24824748 2014 Association between restless legs syndrome and CLOCK and NPAS2 gene polymorphisms in schizophrenia.
24754267 2014 Functional polymorphisms in the NPAS2 gene are associated with overall survival in transcatheter arterial chemoembolization-treated hepatocellular carcinoma patients.
23449886 2013 Common genetic variants in ARNTL and NPAS2 and at chromosome 12p13 are associated with objectively measured sleep traits in the elderly.
More...