Property Summary

NCBI Gene PubMed Count 4
Grant Count 6
Funding $1,596,909.5
PubMed Score 7.07
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.200 0.000
group 4 medulloblastoma -1.300 0.001
medulloblastoma, large-cell -1.400 0.000
primary pancreatic ductal adenocarcinoma -1.092 0.014
adult high grade glioma -1.300 0.001
posterior fossa group A ependymoma -1.100 0.000
psoriasis -2.100 0.000

AA Sequence

MAAPYPGSGGGSEVKCVGGRGASVPWDFLPGLMVKAPSGPCLQAQRKEKSRNAARSRRGKENLEFFELAK      1 - 70
LLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLAPGRRGPAALVSEVFEQHLGG     71 - 140
HILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVEMTGSSVFDYIHPGDHSEVLEQLGLRTPTPGPPTP    141 - 210
PSVSSSSSSSSSLADTPEIEASLTKVPPSSLVQERSFFVRMKSTLTKRGLHVKASGYKVIHVTGRLRAHA    211 - 280
LGLVALGHTLPPAPLAELPLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRI    281 - 350
RQSHVDLLDKGQVMTGYYRWLQRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTPLDAFQL    351 - 420
PASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGKRIKVEPGPRETKGSEDSGDEDPSSHPATP    421 - 490
RPEFTSVIRAGVLKQDPVRPWGLAPPGDPPPTLLHAGFLPPVVRGLCTPGTIRYGPAELGLVYPHLQRLG    491 - 560
PGPALPEAFYPPLGLPYPGPAGTRLPRKGD                                            561 - 590
//

Text Mined References (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9079689 1997 Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway.
9012850 1997 Molecular characterization of two mammalian bHLH-PAS domain proteins selectively expressed in the central nervous system.