Property Summary

NCBI Gene PubMed Count 111
PubMed Score 336.78
PubTator Score 180.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Meier-Gorlin syndrome 10 5.933 3.0
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count
MEIER-GORLIN SYNDROME 5 1

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.029 8.9e-03
adrenocortical carcinoma 1.609 7.0e-04
Atopic dermatitis 1.400 2.0e-03
atypical teratoid / rhabdoid tumor 1.100 6.0e-03
Breast cancer 1.700 1.3e-07
Endometriosis 1.276 4.8e-02
group 3 medulloblastoma 1.900 2.9e-03
lung adenocarcinoma 1.400 4.0e-10
lung cancer 1.700 8.3e-04
malignant mesothelioma 1.600 1.1e-06
medulloblastoma, large-cell 1.800 1.4e-04
nasopharyngeal carcinoma 1.200 3.7e-04
non-small cell lung cancer 2.392 4.3e-22
ovarian cancer 1.100 3.4e-03
pancreatic cancer 1.100 9.4e-04
psoriasis 1.100 4.5e-08
ulcerative colitis 1.100 2.6e-04

Protein-protein Interaction (4)

Gene RIF (78)

AA Sequence

MPQTRSQAQATISFPKRKLSRALNKAKNSSDAKLEPTNVQTVTCSPRVKALPLSPRKRLGDDNLCNTPHL      1 - 70
PPCSPPKQGKKENGPPHSHTLKGRRLVFDNQLTIKSPSKRELAKVHQNKILSSVRKSQEITTNSEQRCPL     71 - 140
KKESACVRLFKQEGTCYQQAKLVLNTAVPDRLPAREREMDVIRNFLREHICGKKAGSLYLSGAPGTGKTA    141 - 210
CLSRILQDLKKELKGFKTIMLNCMSLRTAQAVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPMIV    211 - 280
LVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQ    281 - 350
IVTILQDRLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSP    351 - 420
SEPLIPKRVGLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYS    421 - 490
KVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKEIEHALKDKALIGNILATGLP    491 - 560
//

Text Mined References (117)

PMID Year Title