Property Summary

NCBI Gene PubMed Count 99
Grant Count 184
R01 Count 139
Funding $23,414,877
PubMed Score 321.58
PubTator Score 180.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
group 3 medulloblastoma 1.900 0.003
atypical teratoid/rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 1.900 0.000
Atopic dermatitis 1.400 0.002
adrenocortical carcinoma 1.609 0.001
non-small cell lung cancer 2.392 0.000
lung cancer 2.900 0.000
active Crohn's disease 1.029 0.009
pancreatic cancer 1.100 0.001
lung adenocarcinoma 2.000 0.000
nasopharyngeal carcinoma 1.200 0.000
psoriasis 1.800 0.000
Endometriosis 1.276 0.048
inflammatory breast cancer 2.300 0.001
ulcerative colitis 1.100 0.000
ovarian cancer 1.100 0.003

Synonym

Accession Q99741 Q8TB30
Symbols CDC18L
HsCDC6
MGORS5
HsCDC18

Gene

PDB

4I5L   4I5N   2CCH   2CCI  

Gene RIF (69)

PMID Text
26818844 CDC6 and Cyclin F interact through defined sequence motifs that promote CDC6 ubiquitylation and degradation.
25875233 Cdc6 interacts with centrosomes during mitotic cell division.
25498505 The cell cycle-dependent centrosomal localization of Cdc6 in S and G2 phases suggest a novel function of Cdc6 in centrosomes.
25100863 The current study suggests that miR26a, miR26b, and CDC6 and factors regulating their expression represent potential cancer diagnostic and prognostic markers as well as anticancer targets.
24774443 Aberrant expression of both cyclin D1 and CDC6 by YB-1 over-expression may collaboratively participate in lung carcinogenesis.
24583551 These results provided new evidence for the regulatory mechanism of aberrant CDC6 oncogene transcription by FOXM1 and AR, two highly expressed transcription factors in prostate cancer cells
24434580 Cdk1 contributes to the nuclear export of Cdc6 at the S-to-G2 transition.
24216307 Two nuclear export signals of Cdc6 work cooperatively and distinctly for the cytoplasmic translocation of Cdc6 phosphorylated by cyclin A/Cdk2.
23803736 ORC/Cdc6/MCM2-7 complex is a new regulatory mechanism for the helicase.
23597704 the Nedd8 E1 inhibitor MLN4924 increased CDC6 protein expression due to a delay in cell cycle progression from G1 to S phase, resulting in accumulation of cells with high CDC6 protein levels.
More...

AA Sequence

MPQTRSQAQATISFPKRKLSRALNKAKNSSDAKLEPTNVQTVTCSPRVKALPLSPRKRLGDDNLCNTPHL      1 - 70
PPCSPPKQGKKENGPPHSHTLKGRRLVFDNQLTIKSPSKRELAKVHQNKILSSVRKSQEITTNSEQRCPL     71 - 140
KKESACVRLFKQEGTCYQQAKLVLNTAVPDRLPAREREMDVIRNFLREHICGKKAGSLYLSGAPGTGKTA    141 - 210
CLSRILQDLKKELKGFKTIMLNCMSLRTAQAVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPMIV    211 - 280
LVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQ    281 - 350
IVTILQDRLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSP    351 - 420
SEPLIPKRVGLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYS    421 - 490
KVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKEIEHALKDKALIGNILATGLP    491 - 560
//

Text Mined References (105)

PMID Year Title
26818844 2016 SCF(Cyclin F)-dependent degradation of CDC6 suppresses DNA re-replication.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25875233 2015 Spatio-temporal regulation of the human licensing factor Cdc6 in replication and mitosis.
25498505 2015 Cdc6 localizes to S- and G2-phase centrosomes in a cell cycle-dependent manner.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25100863 2014 MicroRNA-26a/b regulate DNA replication licensing, tumorigenesis, and prognosis by targeting CDC6 in lung cancer.
24774443 2014 YB-1 promotes transcription of cyclin D1 in human non-small-cell lung cancers.
24583551 2014 FOXM1 and androgen receptor co-regulate CDC6 gene transcription and DNA replication in prostate cancer cells.
24434580 2014 PIP-box-mediated degradation prohibits re-accumulation of Cdc6 during S phase.
24216307 2014 Two nuclear export signals of Cdc6 are differentially associated with CDK-mediated phosphorylation residues for cytoplasmic translocation.
More...