Property Summary

NCBI Gene PubMed Count 17
PubMed Score 13.55
PubTator Score 13.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMA      1 - 70
GWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIA     71 - 140
KKLRRQF                                                                   141 - 147
//

Text Mined References (21)

PMID Year Title