Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 5
Funding $396,660.75
PubMed Score 12.28
PubTator Score 13.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99735 D6RBB5 Q7Z5B8 Microsomal GST-2
Symbols GST2
MGST-II

Gene

PANTHER Protein Class (1)

Gene RIF (7)

PMID Text
26066610 Trimeric microsomal protein MGST2 displays one third of the sites reactivity.
23409838 characterized the substrate specificity and catalytic properties of purified MGST2 by steady-state and pre-steady-state kinetic experiments
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
16773312 Observational study of gene-disease association. (HuGE Navigator)
16773312 A large Chinese sample of psoriasis did not provide any supporting evidence for MGST2 to be the psoriasis susceptibility gene within the PSORS9 locus.
16498398 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMA      1 - 70
GWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIA     71 - 140
KKLRRQF                                                                   141 - 147
//

Text Mined References (20)

PMID Year Title
26066610 2015 Trimeric microsomal glutathione transferase 2 displays one third of the sites reactivity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23409838 2013 Catalytic characterization of human microsomal glutathione S-transferase 2: identification of rate-limiting steps.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
16773312 2006 Systematic evaluation of association between the microsomal glutathione S-transferase 2 common variation and psoriasis vulgaris in Chinese population.
16498398 2006 A novel MGST2 non-synonymous mutation in a Chinese pedigree with psoriasis vulgaris.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...