Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.96
PubTator Score 9.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (9)

PMID Text
22190034 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 4 (NAP1L4), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L4 is decreased by RRE
22174317 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 4 (NAP1L4), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L4 is decreased by RRE
21333655 Results identified several proteins interacting with NAP1L2, including the ubiquitously expressed members of the nucleosome assembly protein family, NAP1L1 and NAP1L4.
20644730 Telomeric NAP1L4 and OSBPL5 of the KCNQ1 cluster, and the DECORIN gene are not imprinted in human trophoblast stem cells.
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20002496 The biochemical properties of two human NAP1-like proteins, hNAP1L1 and hNAP1L4, were characterized.
18281699 Human Nap2 promotes nucleosome assembly with H3t/H4.
15368365 NAP-2 is in complex(es) with other proteins, which are distinct from histones
12089333 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 4 (NAP1L4), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L4 is decreased by RRE

AA Sequence

MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINAL      1 - 70
KQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSK     71 - 140
VVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHF    141 - 210
EPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTI    211 - 280
TKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGE    281 - 350
EGEEEELEGDEEGEDEDDAEINPKV                                                 351 - 375
//

Text Mined References (30)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22190034 2011 Global landscape of HIV-human protein complexes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21333655 2011 Interaction between nucleosome assembly protein 1-like family members.
21269460 2011 Initial characterization of the human central proteome.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20644730 2010 Telomeric NAP1L4 and OSBPL5 of the KCNQ1 cluster, and the DECORIN gene are not imprinted in human trophoblast stem cells.
More...