Property Summary

NCBI Gene PubMed Count 63
PubMed Score 113.90
PubTator Score 50.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.200 1.2e-02
Astrocytoma, Pilocytic 1.700 2.7e-06
atypical teratoid / rhabdoid tumor 1.400 9.3e-04
dermatomyositis 1.100 8.9e-04
Down syndrome 1.100 2.6e-03
ependymoma 1.400 1.1e-08
esophageal adenocarcinoma 1.100 3.6e-02
glioblastoma 1.400 2.7e-05
lung cancer -1.500 3.0e-03
lung carcinoma -1.800 3.3e-32
malignant mesothelioma 5.000 1.2e-09
medulloblastoma, large-cell -1.100 1.1e-02
Multiple myeloma 1.080 3.5e-02
osteosarcoma -1.194 4.4e-03
ovarian cancer -2.200 1.1e-06
pancreatic cancer 1.200 8.1e-04
pituitary cancer -1.600 8.3e-05
primary pancreatic ductal adenocarcinoma 1.125 1.3e-03
primitive neuroectodermal tumor 1.500 2.2e-03

Pathway (1)

Gene RIF (37)

AA Sequence

MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN      1 - 70
NNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDA     71 - 140
LQDVDHYCPNCRALLGTYKRL                                                     141 - 161
//

Text Mined References (65)

PMID Year Title