Property Summary

NCBI Gene PubMed Count 75
PubMed Score 253.72
PubTator Score 194.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

 GWAS Trait (1)

Gene RIF (59)

AA Sequence

MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQL      1 - 70
CAPPDQPWVERIIQRLQRTSAKMKRRSS                                               71 - 98
//

Text Mined References (75)

PMID Year Title