Property Summary

NCBI Gene PubMed Count 74
Grant Count 80
R01 Count 49
Funding $6,272,234.06
PubMed Score 231.56
PubTator Score 194.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99731 O00697 O00736
Symbols ELC
CKb11
MIP3B
MIP-3b
SCYA19

Gene

PDB

2MP1  

Gene RIF (60)

PMID Text
26115234 The solution structure of CCL19 is reported. It contains a canonical chemokine domain. Chemical shift mapping shows the N-termini of PSGL-1 and CCR7 have overlapping binding sites for CCL19 and binding is competitive.
25704572 observed significantly higher concentrations of IL-8 (p < 0.001), MCP-1 (p = 0.014), and MIP-3beta (p = 0.022) in the PF of women with endometriosis than in the controls.
25656506 Our findings serve to elucidate the molecular mechanisms underlying the resistin induction of CCL19 expression in ECs and the shear-stress protection against this induction.
25636509 CrkL regulates CCL19 and CCR7-induced epithelial-to-mesenchymal transition via ERK signaling pathway in epithelial ovarian carcinoma patients.
25260647 The mRNA levels of CCL19/CCL21 in ankylosing spondylitis hip ligament were significantly higher than in osteoarthritis ligament.
25256673 The pathogenesis of human prostate cancer may be mediated by the CCL19/CCR7 axis.
25240755 The migration capacity of PLA-p24-loaded human monocyte-derived dendritic cells is significantly higher in the presence of CCL19 than in the absence of this chemokine
25240755 The migration capacity of PLA-p24-loaded human monocyte-derived dendritic cells is significantly higher in the presence of CCL19 than in the absence of this chemokine
25225162 our data suggest that both CCL19 mRNA and protein were obviously expressed in a lower degree in HCC tissues than adjacent non-tumorous liver tissues. The proliferation and migration of cells were distinctly suppressed by CCL19.
24990231 CCL19 promoted monocyte adhesion to HUVEC cells. CCL19 rs2227302 was associated with coronary artery disease in a Chinese Han population.
More...

AA Sequence

MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQL      1 - 70
CAPPDQPWVERIIQRLQRTSAKMKRRSS                                               71 - 98
//

Text Mined References (74)

PMID Year Title
26115234 2015 Solution Structure of CCL19 and Identification of Overlapping CCR7 and PSGL-1 Binding Sites.
25754930 2015 Up-regulation of galectin-9 induces cell migration in human dendritic cells infected with dengue virus.
25704572 2015 Addition of MCP-1 and MIP-3? to the IL-8 appraisal in peritoneal fluid enhances the probability of identifying women with endometriosis.
25656506 2015 Shear Stress Modulates Resistin-Induced CC Chemokine Ligand 19 Expression in Human Aortic Endothelial Cells.
25636509 2015 Crk-like adapter protein regulates CCL19/CCR7-mediated epithelial-to-mesenchymal transition via ERK signaling pathway in epithelial ovarian carcinomas.
25260647 2014 Increased CCL19 and CCL21 levels promote fibroblast ossification in ankylosing spondylitis hip ligament tissue.
25256673 2015 The effect of CCL19/CCR7 on the proliferation and migration of cell in prostate cancer.
25225162 2014 The effect of chemokine CC motif ligand 19 on the proliferation and migration of hepatocellular carcinoma.
24990231 2014 Contribution of homeostatic chemokines CCL19 and CCL21 and their receptor CCR7 to coronary artery disease.
24507453 2014 Increased expression of the homeostatic chemokines CCL19 and CCL21 in clinical and experimental Rickettsia conorii infection.
More...