Property Summary

NCBI Gene PubMed Count 24
Grant Count 9
R01 Count 6
Funding $548,374.6
PubMed Score 10.62
PubTator Score 22.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.501 0.004
Multiple myeloma 2.142 0.000
psoriasis 1.600 0.000
glioblastoma 1.700 0.010
group 3 medulloblastoma 1.800 0.000
astrocytoma 1.600 0.000
medulloblastoma, large-cell 1.200 0.000
primitive neuroectodermal tumor 1.100 0.000
acute quadriplegic myopathy 1.317 0.000
primary pancreatic ductal adenocarcinoma 1.258 0.002
lung cancer 1.200 0.000
ovarian cancer 1.900 0.000

Gene RIF (7)

PMID Text
24638979 Findings define HNRNPAB as an activator of EMT and metastasis in HCC that predicts poor clinical outcomes.
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12692135 physical association of p63alpha and ABBP1 led to a specific shift of FGFR-2 alternative splicing toward the K-SAM isoform essential for epithelial differentiation

AA Sequence

MSEAGEEQPMETTGATENGHEAVPEASRGRGWTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGK      1 - 70
MFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVID     71 - 140
PKKAMAMKKDPVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKK    141 - 210
VLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGY    211 - 280
GYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY                      281 - 332
//

Text Mined References (34)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24638979 2014 HNRNPAB induces epithelial-mesenchymal transition and promotes metastasis of hepatocellular carcinoma by transcriptionally activating SNAIL.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...