Property Summary

NCBI Gene PubMed Count 131
PubMed Score 111.23
PubTator Score 142.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

Gene RIF (107)

PMID Text
26415510 Suggest BARD1 as a driver of proliferation and of pulmonary fibrosis pathogenesis.
26329992 Study presents four different pathogenic BARD1 variants identified in ovarian cancer patients. Three of them result in incorrect splicing of the corresponding exons, which may prompt expression of specific BARD1 isoforms and carcinogenesis.
26022179 a role for the BRCT domain in stimulating BARD1 nuclear export and mitochondrial localization, and in assembling mitochondrial BARD1/p53 complexes to regulate specific activities such as apoptotic function.
25994375 Mutations do not contribute substantially (>> 10% of the total BARD1 mutations) to BARD1 sequence variation and, subsequently, to familial breast and/or ovarian cancer aggregation.
25740706 FOXK2 might act as a negative regulator of ERalpha, and its association with both ERalpha and BRCA1/BARD1 could lead to the down-regulation of ERalpha transcriptional activity, effectively regulating the function of ERalpha.
25657202 Increased expression of the BARD1 protein, with its ubiquitin ligase function, was associated with significantly improved overall and disease-free survival, which has yet to be documented for ACC.
25634209 BARD1 interacts with H3K9me2 through HP1 and plays a critical role in retention of a BRCA1/BARD1 complex at the site of DNA damage.
25008968 BARD1 long non-coding RNA is overexpressed in neoplasms.
24948741 BARD1 is frequently overexpressed in brain metastases from breast cancer and may constitute a mechanism to overcome reactive oxygen species-mediated genotoxic stress in the metastatic brain.
24349422 HDACi (histone deacetylase inhibitor) Vorinostat reduces BARD1 mRNA levels by increasing miR-19a and miR-19b expression levels.
24162774 HIV-1 gp120 upregulates the expression of BRCA1 associated RING domain 1 (BARD1) in human B cells
23966609 SNP sites rs2229571 and rs1048108 of BARD1 are associated with a lower risk of breast cancer but not rs2070094.
23222812 BARD1 is a major gentic contributor to neuroblastoma.
23056176 Data indicate that four nsSNPs, rs4986841, rs111367604, rs13389423 and rs139785364, were identified as deleterious, reducing the protein stability of BARD1, and these SNPs can be used for the larger population-based studies of female cancers.
22883453 SNPs of Pro24Ser(C/T), Arg378Ser (G/C) and Val507Met (G/A) of BARD1 gene are associated with significantly decreased risk of early-onset breast cancer in Uygur women in Xinjiang.
22652532 It is concluded that a proportion of patients with therapy related myeloid neoplasms carry cancer susceptibility mutations,including BARD1 mutations, which is likely to contribute to therapy related leukaemogenesis.
22544576 Our results suggest that BARD1 557Ser and XRCC3 241Met may play roles in BC risk in women with a strong family history of breast cancer (BC).
22350409 our findings identify BARD1beta as an oncogenic driver of high-risk neuroblastoma tumorigenesis
22328350 Single-nucleotide polymorphisms in BARD1 gene is associated to neuroblastoma.
21950761 the BRCA1/BARD1 ubiquitin ligase complex was found to enhance SAFB protein expression and induce Tel2 nuclear translocation
21815143 BARD1 isoforms might be involved in tumor initiation and invasive progression and might represent a novel prognostic marker for non-small cell lung cancer.
21809034 suggests that BARD1 Cys557Ser mutation is not associated with increased breast cancer risk
21693656 Data suggest that BARD1 regulation is an important pathway in colon cancer and that the BARD1 full-length protein may be a useful marker to improve risk stratification in colon cancer patients.
21393566 Genetic variation at BARD1 is not associated with breast cancer risk in BRCA1 or BRCA2 mutation carriers.
21344236 BARD1 mutations may be regarded as cancer risk alleles and warrant further investigation to determine their actual contribution to non-BRCA1/2 breast and ovarian cancer families.
21103343 Data show that inhibition of BRCA1/BARD1 downregulation is accompanied by the unscheduled recruitment of both proteins to chromatin along with Rad51.
20842729 a tumor with homozygous deletion of BARD1 displayed a BRCA1-mutated expression profile; BARD1 might be a breast cancer susceptibility gene with BRCA1-like expression profile
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20077502 analysis of cancer predisposing missense and protein truncating BARD1 mutations in non-BRCA1 or BRCA2 breast cancer families
20077502 Observational study of gene-disease association. (HuGE Navigator)
20060929 BRCA1 and BARD1 are required for estrogen receptor alpha ubiquitination and degradation, and repression of either one leads to ERalpha accumulation, suggesting a feedback loop between BRCA1-BARD1 and estrogen receptor alpha
19959210 The science behind BARD1 and its role in breast and ovarian cancer is explained in this article.
19887602 Our data imply a critical role of UBE2T in development and/or progression of breast cancer through the interaction with and the regulation of the BRCA1/BARD1 complex.
19796682 BARD1 phosphorylation, expression and localisation patterns are regulated in the nucleus and at mitochondria in response to different forms of DNA damage.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19584272 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19482343 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19412175 Common variations in BARD1 contribute to the etiology of the aggressive and most clinically relevant subset of human neuroblastoma.
19412175 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19197335 Four genes encoding BRCA1-interacting proteins were analyzed in a cohort of 96 breast cancer individuals from high-risk non-BRCA1/BRCA2 French Canadian families.
19197335 Observational study of gene-disease association. (HuGE Navigator)
19176389 BARD1 has BRCA1-dependent and BRCA1-independent functions in mitosis. BARD1, but not BRCA1, localizes to the midbody at telophase and cytokinesis, where it colocalizes with Aurora B.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19164445 Data suggest that LXR ligands prevent LXRalpha from ubiquitination and degradation by detaching BARD1/BRCA1, which may be critical for early transactivation of ligand-stimulated LXRalpha through binding of LXRalpha to the promoters of target genes.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19117993 Results suggest that BAP1 and BRCA1/BARD1 coordinately regulate ubiquitination during the DNA damage response and the cell cycle.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064565 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18842000 characterize the BARD1 structural biochemistry responsible for CstF-50 binding
18676680 Observational study of gene-disease association. (HuGE Navigator)
18481171 the BARD1 Cys557Ser variant is not associated with breast cancer risk
18481171 Observational study of gene-disease association. (HuGE Navigator)
18480049 crystallographic analysis of the BARD1 ankyrin repeat domain and its functional consequences
18243530 We propose that BARD1 reduces BRCA1 transcriptional activity, and that this at least partly involves BRCA1/BARD1 E3 ubiquitin ligase activity, which is disrupted by the C61G mutation.
18089818 BARD1 isoform expression is required for cancer cell proliferation, which is compatible with the notion that BARD1 isoforms act as cancer maintenance genes in gynecological cancers.
17972171 BARD1 variants are not associated with breast cancer risk in Australian familial breast cancer.
17972171 Observational study of gene-disease association. (HuGE Navigator)
17678435 BARD1 may regulate the transcriptional activities of p53 as tumor suppressors
17556008 Expression of BARD1 and its isoforms is temporally and spatially regulated by human chorionic gonadotropin and by hypoxia, both factors known to regulate the invasive phase and proliferation of cytotrophoblasts.
17550235 the BARD1 BRCT structure provides insights into the mechanisms by which the cancer-associated missense mutations C645R, V695L, and S761N may adversely affect the structure and function of BARD1.
17497650 we were unable to identify either qualitatively or quantitatively tumor-specific expression patterns of the identified BARD1 splicing variants.
17399677 Observational study of genetic testing. (HuGE Navigator)
17333333 BARD1 mutations may predispose to breast cancer in Poland
17333333 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17275994 ERalpha associated with the ninth intron of the endogenous BARD 1 gene in MCF-7 cells.
17185394 The ubiquitin-proteasome degradation pathway plays a significant role in the coordinated protein stability of BRCA1 and its partner BARD1 in ovarian granulosa cells.
17028982 Observational study of gene-disease association. (HuGE Navigator)
16825437 Observational study of gene-disease association. (HuGE Navigator)
16825437 The Cys557Ser mutation within the BARD1 gene is associated with an increased risk of breast cancer.
16768547 Observational study of gene-disease association. (HuGE Navigator)
16768547 BARD1 Cys557Ser is an ancient variant that confers risk of single and multiple primary breast cancers, and this risk extends to carriers of the BRCA2 999del5 mutation.
16672066 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16333312 Observational study of gene-disease association. (HuGE Navigator)
16333312 Neither Cys557Ser nor Val507Met mutations in BARD1 have an effect on familial breast cancer susceptibility.
16152612 genetic and epigenetic changes might lead to elevated cytoplasmic expression of BARD1 and that cytoplasmic BARD1 might be a poor prognostic factor for breast and ovarian cancers
16061562 Missense mutations in the BARD1 gene may contribute to the cancer phenotype in breast and ovarian cancer.
15886201 BRCA1 and BARD1 can ubiquitinate phosphorylated RNA polymerase II
15855157 BARD1 phosphorylation plays a role in the cellular response to DNA damage
15782130 BARD1, by binding to the kinase and its substrate, catalyses p53 phosphorylation.
15665273 BRCA1 interacts with BARD1 to generate significant ubiquitin ligase activity which catalyzes nontraditional Lys-6-linked polyubiquitin chains in breast csancer.
15632137 BARD1 regulation of the cell cycle is a nuclear event and may be linked to its induced expression during mitosis.
15342711 results suggest a possible role for BARD1 in hereditary susceptibility to breast cancer
15265711 Our findings identify a novel apoptosis inhibitory function of BARD1 and suggest that nuclear retention of BRCA1-BARD1 complexes contributes to both DNA repair and cell survival.
15218362 differential gene expression of Bard1, a tumor suppressor gene, plays a significant role in the proliferation of breast cancer
15184379 BRCA1-BARD1 catalyzes the polyubiquitination of nucleolar phosphoprotein nucleophosmin/B23
15159397 BRCA1-BARD1 complexes act as an adaptor to mediate phosphorylation of p53, influencing G(1)/S cell cycle progression after DNA damage.
14976165 cooperates with BRCA1 to increase ubiquitin conjugation in cells
14647430 BRCA1/BARD1 heterodimer formation is important for optimal nuclear targeting of BARD1 and its role in DNA repair and cell survival.
14638690 BRCA1-BARD1 mediates novel polyubiquitin chains that may be distinctly edited by 26 S proteasome from conventional Lys-48-linked polyubiquitin chains.
14560035 Data show that expression of truncated mouse or human BARD1 peptides capable of interacting with Brca1 results in a homologous-repair deficiency.
14550946 Observational study of gene-disease association. (HuGE Navigator)
12890688 Forms a heterodimer with BRCA1 and the resulting complex functions as an E3 ubiquitin ligase that catalyzes the synthesis of polyubiquitin chains.
12485996 BRCA1/BARD1 catalyses the formation of multiple polyubiquitin chains on itself and potentiates the E3 ubiquitin ligase activity of the BRCA1/BARD1 complex >20-fold
12438698 Purified RINGs, including BARD1, self-assemble into supramolecular structures in vitro that resemble those they form in cells. Self-assembly controls and amplifies E3 ubiquitin conjugation activity of BARD1:BRCA1.
12431996 enhancement of BRCA1 E3 ubiquitin ligase activity through direct interaction with the BARD1 protein
12154023 BRCA1 and BARD1 are associated with the RNA polymerase II holoenzyme.
11943588 It is structurally homologous to BRCA1 (it shares the conserved RING finger and BRCT domains); may be involved in tumor suppression because BARD1-BRCA1 complexes in ubiquination of RNA Pol II and BARD1 interacts with CstF-50 (inhibiting mRNA processing).
11927591 Autoubiquitination of the BRCA1*BARD1 RING ubiquitin ligase.
11925436 BARD1 induces BRCA1 intranuclear foci formation by increasing RING-dependent BRCA1 nuclear import and inhibiting BRCA1 nuclear export
11807980 Germline mutations of BARD1 have been detected in hereditary breast and breast/ovarian cancers negative for BRCA1 and BRCA2 alterations.
11779501 BARD1 acts in p53-Dependent Apoptosis

AA Sequence

MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIF      1 - 70
CSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKK     71 - 140
NSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSYEFVSPSPPADVSERAKKASARSGKKQKKKT    141 - 210
LAEINQKWNLEAEKEDGEFDSKEESKQKLVSFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSL    211 - 280
PLAEQIESPDTKSRNEVVTPEKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQ    281 - 350
TVPSENIPLPECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM    351 - 420
AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTT    421 - 490
GYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVM    491 - 560
NTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWI    561 - 630
LKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGG    631 - 700
QILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSF    701 - 770
ELLPLDS                                                                   771 - 777
//

Text Mined References (137)

PMID Year Title
26415510 2015 BARD1 mediates TGF-? signaling in pulmonary fibrosis.
26329992 2015 Cancer predisposing BARD1 mutations affect exon skipping and are associated with overexpression of specific BARD1 isoforms.
26022179 2015 The BARD1 BRCT domain contributes to p53 binding, cytoplasmic and mitochondrial localization, and apoptotic function.
25994375 2015 Analysis of large mutations in BARD1 in patients with breast and/or ovarian cancer: the Polish population as an example.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25740706 2015 FOXK2 transcription factor suppresses ER?-positive breast cancer cell growth through down-regulating the stability of ER? via mechanism involving BRCA1/BARD1.
25657202 2015 Immunohistochemical validation of overexpressed genes identified by global expression microarrays in adrenocortical carcinoma reveals potential predictive and prognostic biomarkers.
25634209 2015 Interaction of BARD1 and HP1 Is Required for BRCA1 Retention at Sites of DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
25008968 2014 Long non-coding RNA and microRNAs might act in regulating the expression of BARD1 mRNAs.
24948741 2014 DNA double-strand break repair genes and oxidative damage in brain metastasis of breast cancer.
24349422 2013 HDAC inhibitors repress BARD1 isoform expression in acute myeloid leukemia cells via activation of miR-19a and/or b.
23966609 2013 A cross-sectional study of associations between nonsynonymous mutations of the BARD1 gene and breast cancer in Han Chinese women.
23680151 2013 Function of BRCA1 in the DNA damage response is mediated by ADP-ribosylation.
23222812 2013 Replication of GWAS-identified neuroblastoma risk loci strengthens the role of BARD1 and affirms the cumulative effect of genetic variations on disease susceptibility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23056176 2012 Identification of functional SNPs in BARD1 gene and in silico analysis of damaging SNPs: based on data procured from dbSNP database.
22941191 2012 Common variation at 6q16 within HACE1 and LIN28B influences susceptibility to neuroblastoma.
22883453 2012 [Association between single nucleotide polymorphisms of BARD 1 gene and susceptibility of early-onset breast cancer in Uygur women in Xinjiang].
22652532 2012 Germline mutations in the DNA damage response genes BRCA1, BRCA2, BARD1 and TP53 in patients with therapy related myeloid neoplasms.
22544576 2012 The BARD1 Cys557Ser variant and risk of familial breast cancer in a South-American population.
22350409 2012 Common variation at BARD1 results in the expression of an oncogenic isoform that influences neuroblastoma susceptibility and oncogenicity.
22328350 2012 Replication of neuroblastoma SNP association at the BARD1 locus in African-Americans.
21950761 2011 Quantitative proteomic identification of the BRCA1 ubiquitination substrates.
21815143 2012 BARD1: an independent predictor of survival in non-small cell lung cancer.
21809034 2011 Lack of association between BARD1 Cys557Ser variant and breast cancer risk: a meta-analysis of 11,870 cases and 7,687 controls.
21693656 2011 BARD1 expression predicts outcome in colon cancer.
21393566 2011 Common genetic variation at BARD1 is not associated with breast cancer risk in BRCA1 or BRCA2 mutation carriers.
21344236 2012 Cancer predisposing BARD1 mutations in breast-ovarian cancer families.
21124317 2011 Integrative genomics identifies LMO1 as a neuroblastoma oncogene.
21103343 2010 PI 3 kinase related kinases-independent proteolysis of BRCA1 regulates Rad51 recruitment during genotoxic stress in human cells.
20842729 2010 BARD1 homozygous deletion, a possible alternative to BRCA1 mutation in basal breast cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20379136 2010 Nuclear deadenylation/polyadenylation factors regulate 3' processing in response to DNA damage.
20351172 2010 The UBXN1 protein associates with autoubiquitinated forms of the BRCA1 tumor suppressor and inhibits its enzymatic function.
20077502 2010 Cancer predisposing missense and protein truncating BARD1 mutations in non-BRCA1 or BRCA2 breast cancer families.
20060929 2010 Negative feedback loop of BRCA1-BARD1 ubiquitin ligase on estrogen receptor alpha stability and activity antagonized by cancer-associated isoform of BARD1.
19959210 2010 BARD1, a possible biomarker for breast and ovarian cancer.
19887602 2009 Ubiquitination and downregulation of BRCA1 by ubiquitin-conjugating enzyme E2T overexpression in human breast cancer cells.
19796682 2010 Differential modulation of BRCA1 and BARD1 nuclear localisation and foci assembly by DNA damage.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19584272 2009 Modification of ovarian cancer risk by BRCA1/2-interacting genes in a multicenter cohort of BRCA1/2 mutation carriers.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19482343 2009 Polymorphisms in HPV E6/E7 protein interacted genes and risk of cervical cancer in Chinese women: a case-control analysis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19412175 2009 Common variations in BARD1 influence susceptibility to high-risk neuroblastoma.
19261749 2009 NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control.
19261748 2009 MERIT40 facilitates BRCA1 localization and DNA damage repair.
19197335 2009 Genetic sequence variations of BRCA1-interacting genes AURKA, BAP1, BARD1 and DHX9 in French Canadian families with high risk of breast cancer.
19176389 2009 Distinct roles of BARD1 isoforms in mitosis: full-length BARD1 mediates Aurora B degradation, cancer-associated BARD1beta scaffolds Aurora B and BRCA2.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19164445 2009 Liver X receptor ligands suppress ubiquitination and degradation of LXRalpha by displacing BARD1/BRCA1.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19117993 2009 BRCA1-associated protein 1 interferes with BRCA1/BARD1 RING heterodimer activity.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19064565 2008 Common single-nucleotide polymorphisms in DNA double-strand break repair genes and breast cancer risk.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18842000 2008 The BARD1 C-terminal domain structure and interactions with polyadenylation factor CstF-50.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18481171 2009 The BARD1 Cys557Ser polymorphism and breast cancer risk: an Australian case-control and family analysis.
18480049 2008 Crystal structure of the BARD1 ankyrin repeat domain and its functional consequences.
18243530 2008 BARD1 regulates BRCA1-mediated transactivation of the p21WAF1/CIP1 and Gadd45 promoters.
18089818 2007 Oncogenic BARD1 isoforms expressed in gynecological cancers.
17972171 2008 BARD1 variants are not associated with breast cancer risk in Australian familial breast cancer.
17678435 2007 Novel interaction between HPV E6 and BARD1 (BRCA1-associated ring domain 1) and its biologic roles.
17643122 2007 CCDC98 is a BRCA1-BRCT domain-binding protein involved in the DNA damage response.
17556008 2007 Identification of BARD1 splice-isoforms involved in human trophoblast invasion.
17550235 2007 Crystal structure of the BARD1 BRCT domains.
17525342 2007 Ubiquitin-binding protein RAP80 mediates BRCA1-dependent DNA damage response.
17497650 2007 Identification of novel alternatively spliced BRCA1-associated RING domain (BARD1) messenger RNAs in human peripheral blood lymphocytes and in sporadic breast cancer tissues.
17399677 2007 Molecular haplotyping of tandem single nucleotide polymorphisms by allele-specific PCR.
17333333 2008 BARD1 and breast cancer in Poland.
17275994 2007 Estrogen receptor alpha regulates expression of the breast cancer 1 associated ring domain 1 (BARD1) gene through intronic DNA sequence.
17185394 2007 Ubiquitination and proteasome-mediated degradation of BRCA1 and BARD1 during steroidogenesis in human ovarian granulosa cells.
17028982 2007 Common non-synonymous polymorphisms in the BRCA1 Associated RING Domain (BARD1) gene are associated with breast cancer susceptibility: a case-control analysis.
16825437 2006 Nordic collaborative study of the BARD1 Cys557Ser allele in 3956 patients with cancer: enrichment in familial BRCA1/BRCA2 mutation-negative breast cancer but not in other malignancies.
16768547 2006 The BARD1 Cys557Ser variant and breast cancer risk in Iceland.
16672066 2006 SNP-SNP interactions in breast cancer susceptibility.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16333312 2006 BARD1 variants Cys557Ser and Val507Met in breast cancer predisposition.
16152612 2006 Aberrant expression of BARD1 in breast and ovarian cancers with poor prognosis.
16061562 2005 Identification and characterization of missense alterations in the BRCA1 associated RING domain (BARD1) gene in breast and ovarian cancer.
15905410 2005 BRCA1/BARD1 inhibition of mRNA 3' processing involves targeted degradation of RNA polymerase II.
15886201 2005 BRCA1/BARD1 ubiquitinate phosphorylated RNA polymerase II.
15855157 2005 Hyperphosphorylation of the BARD1 tumor suppressor in mitotic cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15782130 2005 BARD1 induces apoptosis by catalysing phosphorylation of p53 by DNA-damage response kinase.
15665273 2005 Down-regulation of BRCA1-BARD1 ubiquitin ligase by CDK2.
15632137 2005 Nuclear targeting and cell cycle regulatory function of human BARD1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15342711 2004 Mutation screening of the BARD1 gene: evidence for involvement of the Cys557Ser allele in hereditary susceptibility to breast cancer.
15265711 2004 BARD1 regulates BRCA1 apoptotic function by a mechanism involving nuclear retention.
15218362 2004 Differential gene expression of TGF beta inducible early gene (TIEG), Smad7, Smad2 and Bard1 in normal and malignant breast tissue.
15184379 2004 Nucleophosmin/B23 is a candidate substrate for the BRCA1-BARD1 ubiquitin ligase.
15159397 2004 BRCA1-BARD1 complexes are required for p53Ser-15 phosphorylation and a G1/S arrest following ionizing radiation-induced DNA damage.
14976165 2004 BRCA1 : BARD1 induces the formation of conjugated ubiquitin structures, dependent on K6 of ubiquitin, in cells during DNA replication and repair.
14647430 2004 Nuclear-cytoplasmic shuttling of BARD1 contributes to its proapoptotic activity and is regulated by dimerization with BRCA1.
14638690 2004 Mass spectrometric and mutational analyses reveal Lys-6-linked polyubiquitin chains catalyzed by BRCA1-BARD1 ubiquitin ligase.
14560035 2003 BARD1 participates with BRCA1 in homology-directed repair of chromosome breaks.
14550946 2003 Mutational analysis of BARD1 in familial breast cancer patients in Japan.
12890688 2003 The BRCA1/BARD1 heterodimer assembles polyubiquitin chains through an unconventional linkage involving lysine residue K6 of ubiquitin.
12781370 2003 3rd Geneva aging workshop 2002: cancer, apoptosis and aging.
12732733 2003 Binding and recognition in the assembly of an active BRCA1/BARD1 ubiquitin-ligase complex.
12611903 2003 Mediator of DNA damage checkpoint protein 1 regulates BRCA1 localization and phosphorylation in DNA damage checkpoint control.
12485996 2002 Activation of the E3 ligase function of the BRCA1/BARD1 complex by polyubiquitin chains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438698 2002 Control of biochemical reactions through supramolecular RING domain self-assembly.
12431996 2003 Enhancement of BRCA1 E3 ubiquitin ligase activity through direct interaction with the BARD1 protein.
12419249 2002 BRCA1 supports XIST RNA concentration on the inactive X chromosome.
12183411 2002 Interaction of the EWS NH2 terminus with BARD1 links the Ewing's sarcoma gene to a common tumor suppressor pathway.
12154023 2002 The BRCA1 and BARD1 association with the RNA polymerase II holoenzyme.
11943588 2002 BRCA1-dependent and independent functions of BARD1.
11927591 2002 Autoubiquitination of the BRCA1*BARD1 RING ubiquitin ligase.
11925436 2002 BARD1 induces BRCA1 intranuclear foci formation by increasing RING-dependent BRCA1 nuclear import and inhibiting BRCA1 nuclear export.
11779501 2001 Identification of BARD1 as mediator between proapoptotic stress and p53-dependent apoptosis.
11777930 2002 BRCA1 regulates GADD45 through its interactions with the OCT-1 and CAAT motifs.
11773071 2002 Identification of residues required for the interaction of BARD1 with BRCA1.
11573085 2001 Structure of a BRCA1-BARD1 heterodimeric RING-RING complex.
11498787 2001 Adenosine nucleotide modulates the physical interaction between hMSH2 and BRCA1.
11257228 2001 The BARD1-CstF-50 interaction links mRNA 3' end formation to DNA damage and tumor suppression.
10764811 2000 Nuclear localization and cell cycle-specific expression of CtIP, a protein that associates with the BRCA1 tumor suppressor.
10477523 1999 Functional interaction of BRCA1-associated BARD1 with polyadenylation factor CstF-50.
10362352 1999 The Bcl-3 oncoprotein acts as a bridging factor between NF-kappaB/Rel and nuclear co-regulators.
10026184 1999 Mapping the functional domains of BRCA1. Interaction of the ring finger domains of BRCA1 and BARD1.
9798686 1998 Conservation of function and primary structure in the BRCA1-associated RING domain (BARD1) protein.
9425226 1998 Mutations in the BRCA1-associated RING domain (BARD1) gene in primary breast, ovarian and uterine cancers.
9342365 1997 Cell cycle-dependent colocalization of BARD1 and BRCA1 proteins in discrete nuclear domains.
8944023 1996 Identification of a RING protein that can interact in vivo with the BRCA1 gene product.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.