Property Summary

NCBI Gene PubMed Count 131
Grant Count 94
R01 Count 56
Funding $8,199,183.54
PubMed Score 111.23
PubTator Score 142.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PDB

1JM7   2NTE   2R1Z   3C5R   3FA2  

Gene RIF (107)

PMID Text
26415510 Suggest BARD1 as a driver of proliferation and of pulmonary fibrosis pathogenesis.
26329992 Study presents four different pathogenic BARD1 variants identified in ovarian cancer patients. Three of them result in incorrect splicing of the corresponding exons, which may prompt expression of specific BARD1 isoforms and carcinogenesis.
26022179 a role for the BRCT domain in stimulating BARD1 nuclear export and mitochondrial localization, and in assembling mitochondrial BARD1/p53 complexes to regulate specific activities such as apoptotic function.
25994375 Mutations do not contribute substantially (>> 10% of the total BARD1 mutations) to BARD1 sequence variation and, subsequently, to familial breast and/or ovarian cancer aggregation.
25740706 FOXK2 might act as a negative regulator of ERalpha, and its association with both ERalpha and BRCA1/BARD1 could lead to the down-regulation of ERalpha transcriptional activity, effectively regulating the function of ERalpha.
25657202 Increased expression of the BARD1 protein, with its ubiquitin ligase function, was associated with significantly improved overall and disease-free survival, which has yet to be documented for ACC.
25634209 BARD1 interacts with H3K9me2 through HP1 and plays a critical role in retention of a BRCA1/BARD1 complex at the site of DNA damage.
25008968 BARD1 long non-coding RNA is overexpressed in neoplasms.
24948741 BARD1 is frequently overexpressed in brain metastases from breast cancer and may constitute a mechanism to overcome reactive oxygen species-mediated genotoxic stress in the metastatic brain.
24349422 HDACi (histone deacetylase inhibitor) Vorinostat reduces BARD1 mRNA levels by increasing miR-19a and miR-19b expression levels.
More...

AA Sequence

MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIF      1 - 70
CSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKK     71 - 140
NSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSYEFVSPSPPADVSERAKKASARSGKKQKKKT    141 - 210
LAEINQKWNLEAEKEDGEFDSKEESKQKLVSFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSL    211 - 280
PLAEQIESPDTKSRNEVVTPEKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQ    281 - 350
TVPSENIPLPECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM    351 - 420
AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTT    421 - 490
GYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVM    491 - 560
NTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWI    561 - 630
LKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGG    631 - 700
QILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSF    701 - 770
ELLPLDS                                                                   771 - 777
//

Text Mined References (137)

PMID Year Title
26415510 2015 BARD1 mediates TGF-? signaling in pulmonary fibrosis.
26329992 2015 Cancer predisposing BARD1 mutations affect exon skipping and are associated with overexpression of specific BARD1 isoforms.
26022179 2015 The BARD1 BRCT domain contributes to p53 binding, cytoplasmic and mitochondrial localization, and apoptotic function.
25994375 2015 Analysis of large mutations in BARD1 in patients with breast and/or ovarian cancer: the Polish population as an example.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25740706 2015 FOXK2 transcription factor suppresses ER?-positive breast cancer cell growth through down-regulating the stability of ER? via mechanism involving BRCA1/BARD1.
25657202 2015 Immunohistochemical validation of overexpressed genes identified by global expression microarrays in adrenocortical carcinoma reveals potential predictive and prognostic biomarkers.
25634209 2015 Interaction of BARD1 and HP1 Is Required for BRCA1 Retention at Sites of DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
25008968 2014 Long non-coding RNA and microRNAs might act in regulating the expression of BARD1 mRNAs.
More...