Property Summary

NCBI Gene PubMed Count 58
PubMed Score 109.22
PubTator Score 89.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.216 5.3e-06
adrenocortical adenoma -1.558 9.5e-05
adrenocortical carcinoma -2.136 9.8e-11
astrocytic glioma 1.400 2.5e-02
Astrocytoma, Pilocytic 3.300 7.7e-05
Atopic dermatitis -1.600 2.5e-03
breast carcinoma -2.100 3.8e-03
cystic fibrosis 1.600 1.3e-02
ductal carcinoma in situ -4.500 2.7e-04
ependymoma 1.600 3.5e-02
fibroadenoma -3.000 1.3e-02
glioblastoma 2.200 6.0e-04
invasive ductal carcinoma -1.096 2.5e-03
lung carcinoma 1.300 6.4e-14
malignant mesothelioma 2.000 9.1e-08
oligodendroglioma 2.900 1.6e-03
osteosarcoma -1.457 3.0e-02
pediatric high grade glioma 2.600 1.6e-03
pituitary cancer -3.400 3.6e-08
psoriasis -1.100 3.6e-04
subependymal giant cell astrocytoma -2.819 3.4e-02

Gene RIF (53)

AA Sequence

MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKM      1 - 70
LRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDL     71 - 140
SLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRG    141 - 210
HLPLRKEFVDIVQP                                                            211 - 224
//

Text Mined References (59)

PMID Year Title