Property Summary

NCBI Gene PubMed Count 53
Grant Count 21
R01 Count 19
Funding $1,623,774.16
PubMed Score 100.25
PubTator Score 89.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
astrocytoma 2.800 0.000
ependymoma 1.600 0.035
oligodendroglioma 2.900 0.002
psoriasis -1.800 0.000
glioblastoma 3.500 0.000
osteosarcoma -1.457 0.030
acute quadriplegic myopathy 1.216 0.000
Atopic dermatitis -1.600 0.003
adrenocortical adenoma -1.558 0.000
adrenocortical carcinoma -2.136 0.000
breast carcinoma -2.100 0.004
fibroadenoma -3.000 0.013
cystic fibrosis 1.600 0.013
pediatric high grade glioma 2.600 0.002
pilocytic astrocytoma 3.300 0.000
subependymal giant cell astrocytoma -2.819 0.034
invasive ductal carcinoma -5.600 0.000
lung carcinoma 1.300 0.000
ductal carcinoma in situ -4.500 0.000
pituitary cancer -3.400 0.000

Gene RIF (48)

PMID Text
26539028 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26291714 regulates carcinogenesis through apoptosis activation in cervical cancer cells
25986893 Upregulation of plasma TIMP-4 might contribute to PIH [pregnancy-induced hypertension] processes
25971370 ncreased TGFB1 expression and decreased TIMP-4 expression correlated with atrial fibrosis and extracellular matrix changes in the atria of rheumatic heart disease patients with atrial fibrillation.
25595263 This study provides evidence that the promoter TIMP4 rs3755724 is a new focal epilepsy susceptibility variant that is plausibly involved in inflammation-induced seizures in Malaysian Chinese.
25300296 Expression levels of TIMP-1, TIMP-3 and TIMP-4 were negligible (<10% of cells) in primary spontaneous pneumothorax lesions.
25128867 No evidence was found for any associations between the TIMP-1,-2,-3, or -4 gene single nucleotide polymorphisms with unexplained recurrent spontaneous abortions in this Han Chinese Han population.
24903383 Data show that gene polymorphisms of TIMP metallopeptidase inhibitors TIMP-3 -1296 T>C (rs9619311) and TIMP-4 -55 T>C (rs3755724) were associated with the susceptibility of hepatocellular carcinoma among Taiwan women.
24637197 Selective myocardial targeting for TIMP-4 induction through either a viral or transgenic approach favorably altered the course of adverse left ventricular remodeling post-myocardial infarction.
23229788 The rs3755724 in TIMP4 protein was nominally associated with schizophrenia with poor concentration.
More...

AA Sequence

MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKM      1 - 70
LRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDL     71 - 140
SLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRG    141 - 210
HLPLRKEFVDIVQP                                                            211 - 224
//

Text Mined References (54)

PMID Year Title
26539028 2015 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26291714 2015 Tissue Inhibitor of Metalloproteinase-4 Triggers Apoptosis in Cervical Cancer Cells.
25986893 2015 Maternal plasma TIMP-4 levels combined with clinical risk factors for the early prediction of pregnancy-induced hypertension.
25971370 2015 TGF-?1 and TIMP-4 regulate atrial fibrosis in atrial fibrillation secondary to rheumatic heart disease.
25595263 2015 Contribution of TIMP4 rs3755724 polymorphism to susceptibility to focal epilepsy in Malaysian Chinese.
25300296 2014 Overexpression of matrix metalloproteinases in lung tissue of patients with primary spontaneous pneumothorax.
25128867 2014 Association of tissue inhibitor of metalloproteinase gene polymorphisms and unexplained recurrent spontaneous abortions in Han Chinese couples.
24903383 2014 TIMP-3 -1296 T>C and TIMP-4 -55 T>C gene polymorphisms play a role in the susceptibility of hepatocellular carcinoma among women.
24637197 2014 Targeted overexpression of tissue inhibitor of matrix metalloproteinase-4 modifies post-myocardial infarction remodeling in mice.
23229788 2013 Assessment of the correlation between TIMP4 SNPs and schizophrenia and autism spectrum disorders.
More...