Property Summary

NCBI Gene PubMed Count 53
PubMed Score 100.25
PubTator Score 89.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
astrocytoma 1493 3.80084859824318E-22
lung carcinoma 2844 6.37617992207734E-14
adrenocortical carcinoma 1427 9.81406885258629E-11
pituitary cancer 1972 3.55525271213234E-8
malignant mesothelioma 3163 9.13738710140264E-8
acute quadriplegic myopathy 1157 5.34801399827233E-6
psoriasis 6685 7.25458001547474E-6
glioblastoma 5572 7.38680957258427E-5
pilocytic astrocytoma 3086 8.66724380223197E-5
adrenocortical adenoma 134 9.50614382414193E-5
invasive ductal carcinoma 2950 1.7339969995639E-4
ductal carcinoma in situ 1745 2.69810603802686E-4
oligodendroglioma 2849 0.0015603903100062
pediatric high grade glioma 2712 0.00159721246481446
Atopic dermatitis 944 0.00254106398914321
breast carcinoma 1614 0.00379592722755078
fibroadenoma 557 0.0130304846377513
cystic fibrosis 1670 0.0134492831440903
osteosarcoma 7933 0.0295669761062321
subependymal giant cell astrocytoma 2287 0.0341050457960613
ependymoma 2514 0.0354705005166554
Disease Target Count Z-score Confidence
Heart disease 279 3.327 1.7
Vascular disease 281 3.222 1.6

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
astrocytoma 2.800 0.000
ependymoma 1.600 0.035
oligodendroglioma 2.900 0.002
psoriasis -1.800 0.000
glioblastoma 3.500 0.000
osteosarcoma -1.457 0.030
acute quadriplegic myopathy 1.216 0.000
Atopic dermatitis -1.600 0.003
adrenocortical adenoma -1.558 0.000
adrenocortical carcinoma -2.136 0.000
breast carcinoma -2.100 0.004
fibroadenoma -3.000 0.013
cystic fibrosis 1.600 0.013
pediatric high grade glioma 2.600 0.002
pilocytic astrocytoma 3.300 0.000
subependymal giant cell astrocytoma -2.819 0.034
invasive ductal carcinoma -5.600 0.000
lung carcinoma 1.300 0.000
ductal carcinoma in situ -4.500 0.000
pituitary cancer -3.400 0.000

Synonym

Accession Q99727 B2R7K6
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (48)

PMID Text
26539028 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26291714 regulates carcinogenesis through apoptosis activation in cervical cancer cells
25986893 Upregulation of plasma TIMP-4 might contribute to PIH [pregnancy-induced hypertension] processes
25971370 ncreased TGFB1 expression and decreased TIMP-4 expression correlated with atrial fibrosis and extracellular matrix changes in the atria of rheumatic heart disease patients with atrial fibrillation.
25595263 This study provides evidence that the promoter TIMP4 rs3755724 is a new focal epilepsy susceptibility variant that is plausibly involved in inflammation-induced seizures in Malaysian Chinese.
25300296 Expression levels of TIMP-1, TIMP-3 and TIMP-4 were negligible (<10% of cells) in primary spontaneous pneumothorax lesions.
25128867 No evidence was found for any associations between the TIMP-1,-2,-3, or -4 gene single nucleotide polymorphisms with unexplained recurrent spontaneous abortions in this Han Chinese Han population.
24903383 Data show that gene polymorphisms of TIMP metallopeptidase inhibitors TIMP-3 -1296 T>C (rs9619311) and TIMP-4 -55 T>C (rs3755724) were associated with the susceptibility of hepatocellular carcinoma among Taiwan women.
24637197 Selective myocardial targeting for TIMP-4 induction through either a viral or transgenic approach favorably altered the course of adverse left ventricular remodeling post-myocardial infarction.
23229788 The rs3755724 in TIMP4 protein was nominally associated with schizophrenia with poor concentration.
More...

AA Sequence

MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKM      1 - 70
LRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDL     71 - 140
SLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRG    141 - 210
HLPLRKEFVDIVQP                                                            211 - 224
//

Text Mined References (54)

PMID Year Title
26539028 2015 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26291714 2015 Tissue Inhibitor of Metalloproteinase-4 Triggers Apoptosis in Cervical Cancer Cells.
25986893 2015 Maternal plasma TIMP-4 levels combined with clinical risk factors for the early prediction of pregnancy-induced hypertension.
25971370 2015 TGF-?1 and TIMP-4 regulate atrial fibrosis in atrial fibrillation secondary to rheumatic heart disease.
25595263 2015 Contribution of TIMP4 rs3755724 polymorphism to susceptibility to focal epilepsy in Malaysian Chinese.
25300296 2014 Overexpression of matrix metalloproteinases in lung tissue of patients with primary spontaneous pneumothorax.
25128867 2014 Association of tissue inhibitor of metalloproteinase gene polymorphisms and unexplained recurrent spontaneous abortions in Han Chinese couples.
24903383 2014 TIMP-3 -1296 T>C and TIMP-4 -55 T>C gene polymorphisms play a role in the susceptibility of hepatocellular carcinoma among women.
24637197 2014 Targeted overexpression of tissue inhibitor of matrix metalloproteinase-4 modifies post-myocardial infarction remodeling in mice.
23229788 2013 Assessment of the correlation between TIMP4 SNPs and schizophrenia and autism spectrum disorders.
More...