Property Summary

NCBI Gene PubMed Count 16
Grant Count 28
R01 Count 24
Funding $4,001,680.92
PubMed Score 104.94
PubTator Score 26.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.200 0.000
glioblastoma -1.400 0.000
oligodendroglioma -1.200 0.000
osteosarcoma 1.560 0.000
ependymoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
primitive neuroectodermal tumor -1.400 0.003
lung cancer 1.500 0.000
pediatric high grade glioma -1.100 0.016
pilocytic astrocytoma -1.400 0.002

Gene RIF (8)

PMID Text
25284286 The results of this study suggested that ZnT3 protein levels are decreased in the spinal cords of sporadic ALS patients.
25104558 An association was found between reduced ZnT3 in the prefrontal cortex and cognitive impairment in patients with either dementia with Lewy bodies or Parkinson's disease dementia.
24953873 this study provides the first evidence of a role for zinc in depression in people with dementia.
23849395 SNPs in SLC30A3 show a gender-specific association with schizophrenia in an East UK cohort.
19521526 SLC30A3 (ZnT3) oligomerization by dityrosine bonds regulates its subcellular localization and metal transport capacity
18639746 Data show that ZNT3 is extensively present in the Abeta-positive plaques in the cortex of human AD brains.
17971500 hZnT-3 is expressed at low levels in leukocytes.
14662799 AIDL cells exhibited a lower expression of zinc transporter 1 (ZnT1) and higher expression of ZnT3 than LNCaP cells.

AA Sequence

MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERL      1 - 70
HARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHR     71 - 140
SETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPHSHGSR    141 - 210
GAEYAPLEEGPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGS    211 - 280
TAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLA    281 - 350
EASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPPQA                                    351 - 388
//

Text Mined References (19)

PMID Year Title
26647834 2015 Loss of synaptic Zn2+ transporter function increases risk of febrile seizures.
25416956 2014 A proteome-scale map of the human interactome network.
25284286 2015 Zinc transporters ZnT3 and ZnT6 are downregulated in the spinal cords of patients with sporadic amyotrophic lateral sclerosis.
25104558 2014 Assessment of ZnT3 and PSD95 protein levels in Lewy body dementias and Alzheimer's disease: association with cognitive impairment.
24953873 2015 Depression and synaptic zinc regulation in Alzheimer disease, dementia with lewy bodies, and Parkinson disease dementia.
23849395 2014 Allelic variants in the zinc transporter-3 gene, SLC30A3, a candidate gene identified from gene expression studies, show gender-specific association with schizophrenia.
19521526 2009 SLC30A3 (ZnT3) oligomerization by dityrosine bonds regulates its subcellular localization and metal transport capacity.
18639746 2008 Abundant expression of zinc transporters in the amyloid plaques of Alzheimer's disease brain.
17971500 2008 Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9.
17349999 2007 Zinc transporter 2 (SLC30A2) can suppress the vesicular zinc defect of adaptor protein 3-depleted fibroblasts by promoting zinc accumulation in lysosomes.
More...