Property Summary

NCBI Gene PubMed Count 22
PubMed Score 111.65
PubTator Score 26.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.200 9.8e-35
Astrocytoma, Pilocytic -1.400 2.0e-03
atypical teratoid / rhabdoid tumor -1.600 3.3e-06
ependymoma -1.400 1.2e-06
glioblastoma -1.400 3.0e-04
lung cancer 1.500 2.0e-04
oligodendroglioma -1.200 2.7e-26
osteosarcoma 1.560 1.9e-08
pediatric high grade glioma -1.100 1.6e-02
primitive neuroectodermal tumor -1.400 3.0e-03

Gene RIF (12)

AA Sequence

MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERL      1 - 70
HARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHR     71 - 140
SETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPHSHGSR    141 - 210
GAEYAPLEEGPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGS    211 - 280
TAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLA    281 - 350
EASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPPQA                                    351 - 388
//

Text Mined References (25)

PMID Year Title