Property Summary

Ligand Count 1,849
NCBI Gene PubMed Count 88
PubMed Score 209.97
PubTator Score 84.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Lateral sclerosis 15 3.042 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.600 3.0e-03
lung cancer 1.900 2.3e-03
medulloblastoma, large-cell 1.300 2.5e-03
ovarian cancer 1.400 3.9e-06
pancreatic ductal adenocarcinoma liver m... -1.255 3.7e-02

Gene RIF (79)

AA Sequence

MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHP      1 - 70
GHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGT     71 - 140
TKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGL    141 - 210
RLELTTYLFGQDP                                                             211 - 223
//

Text Mined References (94)

PMID Year Title