Property Summary

NCBI Gene PubMed Count 81
Grant Count 34
R01 Count 9
Funding $10,957,807.34
PubMed Score 177.50
PubTator Score 84.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.002
pancreatic ductal adenocarcinoma liver m... -2.013 0.000
lung cancer 2.200 0.000
colon cancer 1.600 0.003
ovarian cancer 1.400 0.000

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity

Gene RIF (72)

PMID Text
27042935 crystal structures of the human sigma1 receptor in complex with two chemically divergent ligands, PD144418 and 4-IBP
26792723 Collectively, these studies define Sig1R as a key mediator of TRAIL induction of cancer-specific killing.
26078401 Homozygous c.151+1G>T mutation in SIGMAR1 caused a novel form of autosomal recessive distal hereditary motor neuropathy (dHMN) in a Chinese consanguineous family; endoplasmic reticulum stress may have a role in the pathogenesis of dHMN
25902777 Central and peripheral pharmacological blockade of Sig-1R could be an effective option to treat inflammatory pain--{REVIEW}
25704016 Expression of mutant Sig-1R protein reduces mitochondrial ATP production, inhibits proteasome activity and causes mitochondrial injury, aggravating ER stress-induced neuronal death.
25704015 mutations of the SIGMAR1 gene worsen outcome in Alzheimer's disease and myotrophic lateral sclerosis supporting a role of Sig-1R in neurodegenerative disease.
25704014 overview of the biological mechanisms frequently associated with neurodegeneration, and discuss how sigma-1 receptors may alter these mechanisms to preserve or restore neuronal function.
25704013 Removal of the S1R gene in the Superoxide Dismutase-1 (SOD-1) mouse model of ALS exacerbated the neurodegenerative condition and resulted in a significantly reduced longevity.
25704011 Recent studies indicate that sigma-1 receptors, partly in sake of its unique subcellular localization, regulate the mitochondria function that involves bioenergetics and free radical generation.
25569182 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
More...

AA Sequence

MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHP      1 - 70
GHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGT     71 - 140
TKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGL    141 - 210
RLELTTYLFGQDP                                                             211 - 223
//

Text Mined References (85)

PMID Year Title
27042935 2016 Crystal structure of the human ?1 receptor.
26792723 2016 Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) activates caspases in human prostate cancer cells through sigma 1 receptor.
26078401 2015 A SIGMAR1 splice-site mutation causes distal hereditary motor neuropathy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902777 2015 Sigma-1 receptor and inflammatory pain.
25704016 2015 The role of SIGMAR1 gene mutation and mitochondrial dysfunction in amyotrophic lateral sclerosis.
25704015 2015 The involvement of the sigma-1 receptor in neurodegeneration and neurorestoration.
25704014 2015 Role of sigma-1 receptors in neurodegenerative diseases.
25704013 2015 Role of the Sigma-1 receptor in Amyotrophic Lateral Sclerosis (ALS).
25704011 2015 Sigma-1 receptor: the novel intracellular target of neuropsychotherapeutic drugs.
More...