Property Summary

NCBI Gene PubMed Count 31
Grant Count 14
R01 Count 9
Funding $2,125,306.28
PubMed Score 48.10
PubTator Score 91.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.500 0.000
juvenile dermatomyositis -1.182 0.000
Amyotrophic Lateral Sclerosis -1.076 0.000
diabetes mellitus 2.700 0.001
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.300 0.000
non primary Sjogren syndrome sicca 1.300 0.013
ovarian cancer -1.300 0.000

Gene RIF (5)

PMID Text
18398426 HSP70 and constitutively active HSF1 mediate protection against CDCrel-1-mediated toxicity
17625225 Our finding suggests a role for members of the septin family in the development of proliferative retinal membranes.
16179808 the high expression levels of PNUTL1 in human pancreatic endocrine cells that suggests a similar role of this protein in islet cells to that demonstrated in neuronal tissues, and warrants further functional studies of this protein.
15214843 We studied the assembly of three human septins, SEPT4, SEPT5 and SEPT8, with each other (heterotypic) and with themselves (homotypic) using a yeast two-hybrid system.
14530399 CDCrel-1 overexpression exerts dopamine-dependent neurotoxicity and may contribute to the development of autosomal-recessive juvenile parkinsonism

AA Sequence

MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLY      1 - 70
KDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDE     71 - 140
SGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEI    141 - 210
DKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDF    211 - 280
VKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDE    281 - 350
ELRRMQEMLQRMKQQMQDQ                                                       351 - 369
//

Text Mined References (37)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21563316 2012 Synaptic vesicle trafficking and Parkinson's disease.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18398426 2008 HSP70 and constitutively active HSF1 mediate protection against CDCrel-1-mediated toxicity.
18385322 2008 Cyclin-dependent kinase 5 phosphorylation of human septin SEPT5 (hCDCrel-1) modulates exocytosis.
18088087 2008 Phosphoproteome of resting human platelets.
More...