Property Summary

NCBI Gene PubMed Count 63
Grant Count 35
R01 Count 31
Funding $5,389,739.05
PubMed Score 131.73
PubTator Score 148.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (39)

PMID Text
26884257 Data suggest that HSD10 plays a role in alterations of energy metabolism by regulating mtDNA content in colorectal carcinomas.
26338420 Three HSD10 variants associated with neurodegenerative disorders are inactive with cardiolipin
25925575 The study showed that pathogenic mutations impair SDR5C1-dependent dehydrogenation, tRNA processing and methylation.
25879199 Our findings demonstrate that overexpression of HSD10 accelerates pheochromocytoma cell growth, enhances cell respiration, and increases cellular resistance to cell death induction.
25575635 The authors demonstrate elevated amounts of unprocessed pre-tRNAs and mRNA transcripts encoding mitochondrial subunits indicating deficient RNase P activity in HSD10 disease.
25375021 upon exposure to E2, ERalpha rapidly localizes to mitochondria, in which it interacts with HSD17B10 to modulate the expression of mitochondrial RNA transcripts.
25007702 Defects in this gene are a cause of 17beta-hydroxysteroid dehydrogenase type 10 (HSD10) deficiency. The encoded protein does not exhibit generalized alcohol dehydrogenase activity as was previously thought.
24549042 loss of HSD10 causes impaired mitochondrial precursor transcript processing which may explain mitochondrial dysfunction observed in HSD10 disease
24244276 Significantly higher levels of SRD5A1, AKR1C2, AKR1C3, and HSD17B10 mRNA were however found in bone metastases than in non-malignant and/or malignant prostate tissue
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of hydroxysteroid (17-beta) dehydrogenase 10 (HSD17B10) expression by HIV-1 Vpr in Vpr transduced macrophages
More...

AA Sequence

MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKD      1 - 70
VQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNE     71 - 140
PDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLP    141 - 210
EKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP                       211 - 261
//

Text Mined References (67)

PMID Year Title
26884257 2016 17?-Hydroxysteroid dehydrogenase type 10 predicts survival of patients with colorectal cancer and affects mitochondrial DNA content.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26338420 2015 Myxococcus CsgA, Drosophila Sniffer, and human HSD10 are cardiolipin phospholipases.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25925575 2015 Molecular insights into HSD10 disease: impact of SDR5C1 mutations on the human mitochondrial RNase P complex.
25879199 2015 Overexpression of 17?-hydroxysteroid dehydrogenase type 10 increases pheochromocytoma cell growth and resistance to cell death.
25575635 2015 Mitochondrial energy failure in HSD10 disease is due to defective mtDNA transcript processing.
25375021 2015 Estrogen-mediated regulation of mitochondrial gene expression.
25007702 2014 Roles of 17?-hydroxysteroid dehydrogenase type 10 in neurodegenerative disorders.
24549042 2014 Mutation or knock-down of 17?-hydroxysteroid dehydrogenase type 10 cause loss of MRPP1 and impaired processing of mitochondrial heavy strand transcripts.
More...