Property Summary

NCBI Gene PubMed Count 26
Grant Count 7
R01 Count 7
Funding $668,583
PubMed Score 20.64
PubTator Score 19.20

Knowledge Summary

Patent (2,304)

Expression

Gene RIF (11)

PMID Text
27100087 RNA-seq evidence of biallelic expression of KCNJ15 and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of KCNJ15 is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals.
26449415 KCNJ15 couples with polyamines in sensing weak electric fields.
26108660 KCNJ15 has a major role in histamine-stimulated gastric acid secretion.
23595124 We had performed a replication study using an independent larger Japanese population for the association of rs3746876 within KCNJ15, and observed a significant association of rs3746876 with type 2 diabetes, but this study failed to find original finding.
22566534 It was shown that downregulation of Kcnj15 leads to increased insulin secretion in vitro and in vivo. The mechanism for regulating insulin secretion inolved a calcium-sensiong receptor.
20085713 Observational study of gene-disease association. (HuGE Navigator)
20085713 KCNJ15 is a previously unreported susceptibility gene for T2DM among Asians
19420109 MUPP1 and Kir4.2 may participate in a protein complex in the nephron that could regulate transport of K(+) as well as other ions.
17122384 Calcium-sensing receptor interacts directly with Kir4.1 and Kir4.2 and can decrease their currents.
15068243 The potential synergy and consequences of the overexpression of KIR4.2 and KIR3.2 in Down's syndrome brain development are discussed.
More...

AA Sequence

MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLF      1 - 70
AATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLFSLESQTTIGYGVRSITEECP     71 - 140
HAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQC    141 - 210
QLSGKLLQTHVTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELV    211 - 280
VLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQ    281 - 350
LEEKYRQEDQRERELRTLLLQQSNV                                                 351 - 375
//

Text Mined References (27)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
26449415 2015 KCNJ15/Kir4.2 couples with polyamines to sense weak extracellular electric fields in galvanotaxis.
26108660 2015 Potassium channel KCNJ15 is required for histamine-stimulated gastric acid secretion.
23595124 2013 Replication study for the association of a single-nucleotide polymorphism, rs3746876, within KCNJ15, with susceptibility to type 2 diabetes in a Japanese population.
22566534 2012 Inhibition of glucose-stimulated insulin secretion by KCNJ15, a newly identified susceptibility gene for type 2 diabetes.
20085713 2010 Identification of KCNJ15 as a susceptibility gene in Asian patients with type 2 diabetes mellitus.
19420109 2009 MUPP1 complexes renal K+ channels to alter cell surface expression and whole cell currents.
18391953 2008 Rare independent mutations in renal salt handling genes contribute to blood pressure variation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
More...