Property Summary

NCBI Gene PubMed Count 91
Grant Count 133
R01 Count 78
Funding $14,832,199.42
PubMed Score 142.23
PubTator Score 108.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q99708 A6NKN2 A8K8W6 E7ETY1 O75371 Q8NHQ3
Symbols RIM
COM1
CTIP
JWDS
SAE2
SCKL2

Gene

PDB

2L4Z   4D2H  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
651724 screening 1654 / 5502 / 328376 qHTS Assay for Inhibitors of the CtBP/E1A Interaction
651737 summary 0 / 0 / 0 qHTS Assay for Inhibitors of the CtBP/E1A Interaction

Gene RIF (56)

PMID Text
26502057 Data show that ubiquitin E2 enzymes UBE2D1/2/3 and E3 ligase RNF138 accumulate at DNA-damage sites and act at early resection stages by promoting CtIP protein ubiquitylation and accrual.
26387952 USP4 cooperates with CtIP in DNA double-strand break end resection.
26333564 Homozygous RBBP8 mutation is associated with microcephaly, intellectual disability, short stature and brachydactyly.
25957490 CtIP is a DNA damage response protein at the intersection of DNA metabolism. (Review)
25909997 BRCA1 and CtIP contribute to DSB resection by recruiting Dna2 to damage sites, thus ensuring the robust DSB resection necessary for efficient homologous recombination.
25771978 findings provide strong evidence that CtIP is continuously recruited to DSBs downstream of both the initiation and extension step of resection
25349192 CtIP interacts with Cdh1 through a conserved KEN box, mutation of which impedes ubiquitylation and downregulation of CtIP both during G1 and after DNA damage in G2.
25308476 The CtIP 3'UTR is directly targeted by miR-19a and miR-19b.
25267294 Plk3 binds to CtIP phosphorylated at S327 via its Polo box domains, which is necessary for robust damage-induced CtIP phosphorylation at S327 and subsequent CtIP phosphorylation at T847.
25053769 Possible association of SOX-17 and RBBP8 with brain arteriovenous malformations, genes involved in cell cycle progression, deserves further investigation
More...

AA Sequence

MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERILDAQRLEEFFTKNQQLREQQ      1 - 70
KVLHETIKVLEDRLRAGLCDRCAVTEEHMRKKQQEFENIRQQNLKLITELMNERNTLQEENKKLSEQLQQ     71 - 140
KIENDQQHQAAELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCANEMRKVSKSS    141 - 210
THPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKSSFNLATVVAETLGLGVQEESETQGPMSPLGD    211 - 280
ELYHCLEGNHKKQPFEESTRNTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSL    281 - 350
LQPGKKKHLKTLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQSSNKQILINKNISESLGEQN    351 - 420
RTEYGKDSNTDKHLEPLKSLGGRTSKRKKTEEESEHEVSCPQASFDKENAFPFPMDNQFSMNGDCVMDKP    421 - 490
LDLSDRFSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECII    491 - 560
LQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVLDDIKSAGSHEPIKIQTRSDHGGCELASVLQ    561 - 630
LNPCRTGKIKSLQNNQDVSFENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVL    631 - 700
LKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEEYESCLADSFSQAADEEEELSTATKKLHTHGDKQDK    701 - 770
VKQKAFVEPYFKGDERETSLQNFPHIEVVRKKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRF    771 - 840
RYIPPNTPENFWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT                 841 - 897
//

Text Mined References (104)

PMID Year Title
27561354 2016 Cullin3-KLHL15 ubiquitin ligase mediates CtIP protein turnover to fine-tune DNA-end resection.
26807646 2016 EXD2 promotes homologous recombination by facilitating DNA end resection.
26502057 2015 Systematic E2 screening reveals a UBE2D-RNF138-CtIP axis promoting DNA repair.
26387952 2015 The Deubiquitylating Enzyme USP4 Cooperates with CtIP in DNA Double-Strand Break End Resection.
26333564 2015 RBBP8 syndrome with microcephaly, intellectual disability, short stature and brachydactyly.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25957490 2015 CtIP: A DNA damage response protein at the intersection of DNA metabolism.
25909997 2015 BRCA1 and CtIP Are Both Required to Recruit Dna2 at Double-Strand Breaks in Homologous Recombination.
25771978 2015 Novel characteristics of CtIP at damage-induced foci following the initiation of DNA end resection.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
More...