Property Summary

NCBI Gene PubMed Count 359
Grant Count 169
R01 Count 106
Funding $23,992,629.53
PubMed Score 289.98
PubTator Score 153.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma -1.149 0.003
acute quadriplegic myopathy 1.376 0.000
group 4 medulloblastoma -1.300 0.005
progressive supranuclear palsy -1.500 0.007
ovarian cancer 1.500 0.004

Synonym

Accession Q99707 A1L4N8 A9Z1W4 B7ZLW7 B9EGF7 Q99713 Q99723
Symbols MS
HMAG
cblG

Gene

MTR

PANTHER Protein Class (2)

PDB

2O2K   4CCZ  

 GWAS Trait (1)

Gene RIF (391)

PMID Text
26833750 MTR A2756G single nucleotide polymorphism is significantly associated with gastric cancer risk in Korea.
26595280 According to our results, the MTR A2756G polymorphism was associated with the risk of retinoblastoma in Iranian patients.
26337056 Low folate status and homocysteine metabolism gene polymorphisms (MTHFR C677T, MTHFR A1298C, MTR A2756G and MTRR A66G) may have a synergistic effect towards increasing the incidence of dyslipidemia in Chinese hypertensive population.
26334892 Methionine synthase (MTR) and methionine synthase reductase (MTRR) polymorphisms were significantly associated with the increased neural tube defects risk in a Chinese population.
26299783 Data suggest impaired folate metabolism down-regulates placenta trophoblast proliferation, viability, invasive capacity, and progesterone secretion; silencing MTR gene down-regulates cell proliferation and up-regulates progesterone secretion.
26266420 interactions among homocysteine metabolism gene polymorphisms in MTHFR, MTR and MTRR lead to dramatic elevations in the folate deficiency risk
26196053 no association of rs1805087 with non-obstructive azoospermia
26154858 polymorphisms of the MTHFR, MTRR, and MTR enzymes are well documented as folate deficiency-related disorders. The aim of this study was to compare the genotypic distribution of these gene polymorphisms between patients with acromegaly and controls.
26090795 Variation in MTHFR, MTR, and MTRR were significantly associated with percent LINE-1 methylation.DNA methylation of LINE-1 elements in histologically normal breast tissues is influenced by polymorphisms in genes in the one-carbon metabolism pathway
26063524 MTR genetic polymorphisms are risk factor for predicting cardiovascular manifestations in Marfan syndrome.
More...

AA Sequence

MSPALQDLSQPEGLKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDIL      1 - 70
SITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKR     71 - 140
FVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQ    141 - 210
NLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTA    211 - 280
YVLCYPNAGLPNTFGDYDETPSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATA    281 - 350
FEGHMLLSGLEPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDG    351 - 420
MLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKK    421 - 490
YGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHA    491 - 560
TKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHKELLQL    561 - 630
CEDLIWNKDPEATEKLLRYAQTQGTGGKKVIQTDEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKK    631 - 700
YPRPLNIIEGPLMNGMKIVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDP    701 - 770
YQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM    771 - 840
IFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEIM    841 - 910
EEYEDIRQDHYESLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFD    911 - 980
VWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLYAEA    981 - 1050
AVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDD   1051 - 1120
YSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMW   1121 - 1190
RLADIEQSTGIRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPIL   1191 - 1260
GYDTD                                                                    1261 - 1265
//

Text Mined References (361)

PMID Year Title
26833750 2016 Dietary folate, one-carbon metabolism-related genes, and gastric cancer risk in Korea.
26595280 2015 Methionine synthase A2756G variation is associated with the risk of retinoblastoma in Iranian children.
26337056 2015 Joint associations of folate, homocysteine and MTHFR, MTR and MTRR gene polymorphisms with dyslipidemia in a Chinese hypertensive population: a cross-sectional study.
26334892 2015 Analysis of MTR and MTRR Polymorphisms for Neural Tube Defects Risk Association.
26299783 2015 Altered folate metabolism modifies cell proliferation and progesterone secretion in human placental choriocarcinoma JEG-3 cells.
26266420 2015 Homocysteine Metabolism Gene Polymorphisms (MTHFR C677T, MTHFR A1298C, MTR A2756G and MTRR A66G) Jointly Elevate the Risk of Folate Deficiency.
26196053 2015 Association between genetic polymorphisms in folate-related enzyme genes and infertile men with non-obstructive azoospermia.
26154858 2015 An Association Study Between Gene Polymorphisms of Folic Acid Metabolism Enzymes and Biochemical and Hormonal Parameters in Acromegaly.
26090795 2015 Associations between genetic variation in one-carbon metabolism and LINE-1 DNA methylation in histologically normal breast tissues.
26063524 2015 Gene polymorphisms as risk factors for predicting the cardiovascular manifestations in Marfan syndrome. Role of folic acid metabolism enzyme gene polymorphisms in Marfan syndrome.
More...