Property Summary

NCBI Gene PubMed Count 127
Grant Count 30
R01 Count 14
Funding $3,035,566.64
PubMed Score 74.34
PubTator Score 945.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 0.014
tuberculosis and treatment for 6 months -1.500 0.008
diabetes mellitus 1.200 0.001
psoriasis 2.500 0.000

Gene RIF (117)

PMID Text
26823774 Decreased level of KIR2DL4 rather than its single nucleotide polymorphism is correlated with the susceptibility of pre-eclampsia
25855135 The 9620 9A/10A (rs11410751) polymorphism in exon 7 did not influence the risk of NSCLC.
25818657 Among 438 Polish people, a weak difference was seen between males and females in 9769 C/A genotypes and alleles. Fertile women had a high frequency of homozygosity for the defective 9A variant, so KIR2DL4 is not absolutely necessary for reproduction.
25759384 The unique functional properties of KIR2DL4 may be mediated by self-association of the receptor.
25735953 the KIR2DL4 on human mast cells facilitates HLA-G-expressing cancer invasion and the subsequent metastasis.
25451741 Results show that HLA-E and KIR2DL4 demonstrate evidence of positive selection between human, chimpanzee and gorilla suggesting a main role for immunological adaptations linked to embryo deep invasion of the maternal endometrium during pregnancy.
24337374 Abs to KIR2DL4 and HLA-G did not block NK cell IFN-gamma production.
24127555 KIR2DL4 was found to directly interact with HS/heparin, and the D0 domain of KIR2DL4 was essential for this interaction.
24033084 Genetic polymorphism of KIR2DL4, a putative NK cell receptor for HLA-G, does not influence susceptibility to asthma.
23952617 Array CGH showed a 95 Kb de novo duplication on chromosome 19q13.4 encompassing four killer cell immunoglobulin-like receptor (KIR) genes.
More...

AA Sequence

MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPV      1 - 70
PELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGE     71 - 140
NVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPS    141 - 210
DPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHRWCSKKKDAAVMNQEPA    211 - 280
GHRTVNREDSDEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQ    281 - 350
ALMGSSRETTALSQTQLASSNVPAAGI                                               351 - 377
//

Text Mined References (128)

PMID Year Title
26823774 2015 KIR2DL4 expression rather than its single nucleotide polymorphisms correlates with pre-eclampsia.
25855135 2015 Genetic polymorphisms and expression of HLA-G and its receptors, KIR2DL4 and LILRB1, in non-small cell lung cancer.
25818657 2015 Genetic polymorphism of KIR2DL4 in the Polish population.
25759384 2015 The structure of the atypical killer cell immunoglobulin-like receptor, KIR2DL4.
25735953 2015 The Killer Cell Ig-like Receptor 2DL4 Expression in Human Mast Cells and Its Potential Role in Breast Cancer Invasion.
25451741 2015 Adaptive evolution at immune system genes and deep pregnancy implantation in primates.
25416956 2014 A proteome-scale map of the human interactome network.
24337374 2014 Killer Ig-like receptor 2DL4 does not mediate NK cell IFN-? responses to soluble HLA-G preparations.
24127555 2013 Genome-wide siRNA screen reveals a new cellular partner of NK cell receptor KIR2DL4: heparan sulfate directly modulates KIR2DL4-mediated responses.
24033084 2013 Genetic polymorphism of KIR2DL4 (CD158d), a putative NK cell receptor for HLA-G, does not influence susceptibility to asthma.
More...