Property Summary

NCBI Gene PubMed Count 129
PubMed Score 75.09
PubTator Score 945.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.2e-22
diabetes mellitus 1728 1.3e-03
tuberculosis 2010 4.9e-03
cutaneous lupus erythematosus 1057 1.4e-02

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 1.4e-02
diabetes mellitus 1.200 1.3e-03
psoriasis 2.500 5.2e-22
tuberculosis -1.300 4.9e-03

Gene RIF (119)

AA Sequence

MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPV      1 - 70
PELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGE     71 - 140
NVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPS    141 - 210
DPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHRWCSKKKDAAVMNQEPA    211 - 280
GHRTVNREDSDEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQ    281 - 350
ALMGSSRETTALSQTQLASSNVPAAGI                                               351 - 377
//

Text Mined References (130)

PMID Year Title