Property Summary

NCBI Gene PubMed Count 8
Grant Count 12
R01 Count 4
Funding $1,788,160.33
PubMed Score 7.37
PubTator Score 2.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.581 0.000
group 4 medulloblastoma 1.400 0.000

Gene RIF (2)

PMID Text
26354419 Findings support a model in which Meis3 is required for neural crest proliferation, migration into, and colonization of the gut such that its loss leads to severe defects in enteric nervous system development.
20553494 This work suggests that the transcriptional activity of all members of the Meis/Prep Hth protein family is subject to autoinhibition by their Hth domains, and that the Meis3.2 splice variant encodes a protein that bypasses this autoinhibitory effect.

AA Sequence

MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLA      1 - 70
LVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVL     71 - 140
RFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDS    141 - 210
GSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAW    211 - 280
LFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTET    281 - 350
QPHVAVRPPGSVGMSLNLEGEWHYL                                                 351 - 375
//

Text Mined References (10)

PMID Year Title
26763390 2016 MEIS3 is repressed in A549 lung epithelial cells by deoxynivalenol and the repression contributes to the deleterious effect.
26354419 2015 Meis3 is required for neural crest invasion of the gut during zebrafish enteric nervous system development.
20553494 2010 An autoinhibitory effect of the homothorax domain of Meis2.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17178831 2007 Regulation of EphA8 gene expression by TALE homeobox transcription factors during development of the mesencephalon.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9049632 1997 Identification of a conserved family of Meis1-related homeobox genes.
8950991 1996 Identification of a new family of Pbx-related homeobox genes.