Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.38
PubTator Score 2.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 8.5e-06
group 4 medulloblastoma 1855 1.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.400 1.4e-04
osteosarcoma 1.581 8.5e-06

Gene RIF (2)

AA Sequence

MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLA      1 - 70
LVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVL     71 - 140
RFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDS    141 - 210
GSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAW    211 - 280
LFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTET    281 - 350
QPHVAVRPPGSVGMSLNLEGEWHYL                                                 351 - 375
//

Text Mined References (10)

PMID Year Title