Property Summary

NCBI Gene PubMed Count 45
Grant Count 95
R01 Count 33
Funding $7,854,466.82
PubMed Score 147.37
PubTator Score 191.65

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 MGL
Symbols MGL
HUK5
MAGL
HU-K5

Gene

PANTHER Protein Class (3)

PDB

3HJU   3JW8   3JWE   3PE6   4UUQ  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

Gene RIF (33)

PMID Text
26997225 This study unravels a novel mechanism of SND1 function and identifies MGLL as a unique tumor suppressor for HCC. MGLL might function as a homeostatic regulator of Akt restraining its activation.
26555264 The data highlight specific inter-residue interactions within hMGL
26000748 Monoacylglycerol lipase sulfenylation might act as an intrinsic neuroprotective mechanism by potentiating 2-AG signaling at CB1 receptors.
25636199 The study identified monoacylglycerol lipase as a YAP transcriptional target and an inhibitor of anchorage-dependent cell growth.
25120746 Our findings establish that MAGL promotes metastases in nasopharyngeal carcinoma
25078047 Molecular dynamics and nudged elastic band simulations were used to explore the conformational transition pathway of the helix alpha4 of human monoacylglycerol lipase.
24633487 role of monoacylglycerol lipase (MAGL) in the cancer progress
24616451 In subcutaneous adipose tissue, DAGL-a mRNA was upregulated and fatty acid amide hydrolase (FAAH) and monoacylglycerol lipase (MAGL) mRNAs were down-regulated in obese subjects, but the diets had no influence.
24593280 In obese humans, FAAH or MGL activity in adipocytes is not affected by diabetes, dyslipidaemia or other markers of metabolic dysfunction.
24368842 Mutation of Cys242 was also found to impair inhibition of monoacylglycerol lipase.
More...

AA Sequence

MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDL      1 - 70
LVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFA     71 - 140
GMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFG    141 - 210
IQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTN    211 - 280
SVFHEINMWVSQRTATAGTASPP                                                   281 - 303
//

Text Mined References (49)

PMID Year Title
26997225 2016 Staphylococcal Nuclease and Tudor Domain Containing 1 (SND1 Protein) Promotes Hepatocarcinogenesis by Inhibiting Monoglyceride Lipase (MGLL).
26555264 2016 Specific Inter-residue Interactions as Determinants of Human Monoacylglycerol Lipase Catalytic Competency: A ROLE FOR GLOBAL CONFORMATIONAL CHANGES.
26000748 2015 Peroxide-Dependent MGL Sulfenylation Regulates 2-AG-Mediated Endocannabinoid Signaling in Brain Neurons.
25636199 2015 YAP-mediated induction of monoacylglycerol lipase restrains oncogenic transformation.
25120746 2014 Monoacylglycerol lipase promotes metastases in nasopharyngeal carcinoma.
25078047 2014 Conformational transition pathway in the inhibitor binding process of human monoacylglycerol lipase.
24633487 2014 The role of monoacylglycerol lipase (MAGL) in the cancer progress.
24616451 2014 Influence of dietary fat intake on the endocannabinoid system in lean and obese subjects.
24593280 2014 The effects of obesity, diabetes and metabolic syndrome on the hydrolytic enzymes of the endocannabinoid system in animal and human adipocytes.
24368842 2014 Mutation of Cys242 of human monoacylglycerol lipase disrupts balanced hydrolysis of 1- and 2-monoacylglycerols and selectively impairs inhibitor potency.
More...