Property Summary

Ligand Count 176
NCBI Gene PubMed Count 49
PubMed Score 314.71
PubTator Score 191.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -1.700 2.0e-04
astrocytic glioma -1.300 1.1e-02
atypical teratoid / rhabdoid tumor -2.900 2.0e-06
breast carcinoma -1.100 3.1e-11
colon cancer -1.100 1.4e-02
ductal carcinoma in situ -1.900 1.1e-03
ependymoma -1.100 9.2e-05
glioblastoma -1.500 1.5e-06
group 3 medulloblastoma -2.000 3.9e-04
intraductal papillary-mucinous adenoma (... 2.300 2.6e-04
intraductal papillary-mucinous carcinoma... 2.200 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 1.9e-02
invasive ductal carcinoma -2.600 2.3e-03
lung cancer -1.900 1.3e-04
lung carcinoma -1.400 3.5e-32
malignant mesothelioma -2.300 2.2e-07
medulloblastoma, large-cell -3.000 1.0e-04
nasopharyngeal carcinoma -1.100 3.8e-08
non-small cell lung cancer -1.411 3.6e-13
osteosarcoma -1.582 2.7e-02
pancreatic cancer 1.700 8.5e-06
primary pancreatic ductal adenocarcinoma 2.166 2.6e-03
primitive neuroectodermal tumor -2.700 1.6e-05
psoriasis 1.900 1.7e-04
subependymal giant cell astrocytoma -2.463 4.5e-03
ulcerative colitis -1.100 5.7e-04

Protein-protein Interaction (1)

Gene RIF (37)

AA Sequence

MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDL      1 - 70
LVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFA     71 - 140
GMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFG    141 - 210
IQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTN    211 - 280
SVFHEINMWVSQRTATAGTASPP                                                   281 - 303
//

Text Mined References (53)

PMID Year Title