Property Summary

NCBI Gene PubMed Count 45
PubMed Score 147.37
PubTator Score 191.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Osteoporosis 259
Disease Target Count P-value
lung carcinoma 2844 3.46085876968521E-32
non-small cell lung cancer 2798 6.41052392324007E-15
breast carcinoma 1614 3.07352841842206E-11
nasopharyngeal carcinoma 1056 5.44395265668359E-10
medulloblastoma 1524 1.46608359403381E-7
malignant mesothelioma 3163 2.1897446881985E-7
posterior fossa group A ependymoma 1511 7.12723398022966E-7
atypical teratoid / rhabdoid tumor 4369 9.14731000962361E-7
primitive neuroectodermal tumor 3031 1.5651287332371E-5
pediatric high grade glioma 2712 3.40271731351442E-5
lung cancer 4473 1.33927070065321E-4
medulloblastoma, large-cell 6234 1.47533857261594E-4
psoriasis 6685 1.68208244439229E-4
glioblastoma 5572 2.24557528578446E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.60218604663965E-4
ulcerative colitis 2087 5.6584259808865E-4
ductal carcinoma in situ 1745 8.18263362321662E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00136813708613969
invasive ductal carcinoma 2950 0.00192079726567837
subependymal giant cell astrocytoma 2287 0.00451437227843261
pancreatic cancer 2300 0.0112466293747291
astrocytic glioma 2241 0.0112633465696425
primary pancreatic ductal adenocarcinoma 1271 0.0114086124564717
colon cancer 1475 0.0136422938289372
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0174629540378932
osteosarcoma 7933 0.0271888334615999
Disease Target Count Z-score Confidence
Cannabis dependence 18 3.081 1.5

Expression

Synonym

Accession Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 MGL
Symbols MGL
HUK5
MAGL
HU-K5

Gene

PANTHER Protein Class (3)

PDB

3HJU   3JW8   3JWE   3PE6   4UUQ  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

Gene RIF (33)

PMID Text
26997225 This study unravels a novel mechanism of SND1 function and identifies MGLL as a unique tumor suppressor for HCC. MGLL might function as a homeostatic regulator of Akt restraining its activation.
26555264 The data highlight specific inter-residue interactions within hMGL
26000748 Monoacylglycerol lipase sulfenylation might act as an intrinsic neuroprotective mechanism by potentiating 2-AG signaling at CB1 receptors.
25636199 The study identified monoacylglycerol lipase as a YAP transcriptional target and an inhibitor of anchorage-dependent cell growth.
25120746 Our findings establish that MAGL promotes metastases in nasopharyngeal carcinoma
25078047 Molecular dynamics and nudged elastic band simulations were used to explore the conformational transition pathway of the helix alpha4 of human monoacylglycerol lipase.
24633487 role of monoacylglycerol lipase (MAGL) in the cancer progress
24616451 In subcutaneous adipose tissue, DAGL-a mRNA was upregulated and fatty acid amide hydrolase (FAAH) and monoacylglycerol lipase (MAGL) mRNAs were down-regulated in obese subjects, but the diets had no influence.
24593280 In obese humans, FAAH or MGL activity in adipocytes is not affected by diabetes, dyslipidaemia or other markers of metabolic dysfunction.
24368842 Mutation of Cys242 was also found to impair inhibition of monoacylglycerol lipase.
More...

AA Sequence

MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDL      1 - 70
LVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFA     71 - 140
GMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFG    141 - 210
IQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTN    211 - 280
SVFHEINMWVSQRTATAGTASPP                                                   281 - 303
//

Text Mined References (49)

PMID Year Title
26997225 2016 Staphylococcal Nuclease and Tudor Domain Containing 1 (SND1 Protein) Promotes Hepatocarcinogenesis by Inhibiting Monoglyceride Lipase (MGLL).
26555264 2016 Specific Inter-residue Interactions as Determinants of Human Monoacylglycerol Lipase Catalytic Competency: A ROLE FOR GLOBAL CONFORMATIONAL CHANGES.
26000748 2015 Peroxide-Dependent MGL Sulfenylation Regulates 2-AG-Mediated Endocannabinoid Signaling in Brain Neurons.
25636199 2015 YAP-mediated induction of monoacylglycerol lipase restrains oncogenic transformation.
25120746 2014 Monoacylglycerol lipase promotes metastases in nasopharyngeal carcinoma.
25078047 2014 Conformational transition pathway in the inhibitor binding process of human monoacylglycerol lipase.
24633487 2014 The role of monoacylglycerol lipase (MAGL) in the cancer progress.
24616451 2014 Influence of dietary fat intake on the endocannabinoid system in lean and obese subjects.
24593280 2014 The effects of obesity, diabetes and metabolic syndrome on the hydrolytic enzymes of the endocannabinoid system in animal and human adipocytes.
24368842 2014 Mutation of Cys242 of human monoacylglycerol lipase disrupts balanced hydrolysis of 1- and 2-monoacylglycerols and selectively impairs inhibitor potency.
More...