Property Summary

NCBI Gene PubMed Count 54
Grant Count 174
R01 Count 110
Funding $15,936,314.12
PubMed Score 163.04
PubTator Score 156.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 0.003
osteosarcoma -4.726 0.000
lung cancer -1.400 0.004

Synonym

Accession Q99684 Q8N564
Symbols SCN2
GFI-1
GFI1A
ZNF163

Gene

Gene RIF (37)

PMID Text
27143377 Gfi1 gene expression is regulated by cytokines in activated T cells.
26447191 Gfi1 acts as a transcriptional repressor by recruiting histone-modifying enzymes to promoters and enhancers of target genes. Mutations of the C-terminal zinc finger domain causes congenital neutropenia. It may be involved in leukemia and lymphoma. Review.
26160036 miR-495 directly interacts with the Gfi1 3'UTR to regulate Gfi1 at a post-transcriptional level and the expression level of miR-495 is inversely correlated with the Gfi1 protein level in medulloblastoma specimens.
25043047 results, supported by evidence from mouse models, identify GFI1 and GFI1B as prominent medulloblastoma oncogenes and implicate 'enhancer hijacking' as an efficient mechanism driving oncogene activation in a childhood cancer
24830456 During infection, the incoming HCMV rapidly downregulates the GFI1 mRNA and protein in both wild-type cells and in cells in which EZH2, NDY1/KDM2B or JARID2 were knocked down.
24198842 Lymphoid progenitor cells from childhood acute lymphoblastic leukemia are functionally deficient and express high levels of the transcriptional repressor Gfi-1.
24121275 Data shows that MYB regulates the expression of endogenous human GFI1.
24023884 GFI1 is repressed by p53
24018353 the expression of Gfi-1 contributes to SOCS1 silencing in AML cells through epigenetic modification, and suppression of histone methyltransferase can provide new insight in AML therapy.
23528269 Studies indicate that Gfi1 recruits LSD1 to p53 and dampens its activity by de-methylating p53 at C-terminal lysines to prevent immediate apoptosis.
More...

AA Sequence

MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASA      1 - 70
SPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYR     71 - 140
PCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGL    141 - 210
YERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSG    211 - 280
TRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFH    281 - 350
QKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHG    351 - 420
LK                                                                        421 - 422
//

Text Mined References (54)

PMID Year Title
27143377 [Cytokine-mediated regulation of expression of Gfi1 and U2afll4 genes activated by T-cells with different differentiation status in vitro].
26447191 2015 From cytopenia to leukemia: the role of Gfi1 and Gfi1b in blood formation.
26160036 2015 MiR-495 is a Predictive Biomarker that Downregulates GFI1 Expression in Medulloblastoma.
25043047 2014 Enhancer hijacking activates GFI1 family oncogenes in medulloblastoma.
24830456 2014 The downregulation of GFI1 by the EZH2-NDY1/KDM2B-JARID2 axis and by human cytomegalovirus (HCMV) associated factors allows the activation of the HCMV major IE promoter and the transition to productive infection.
24198842 2013 Lymphoid progenitor cells from childhood acute lymphoblastic leukemia are functionally deficient and express high levels of the transcriptional repressor Gfi-1.
24121275 2014 The MYB proto-oncogene suppresses monocytic differentiation of acute myeloid leukemia cells via transcriptional activation of its target gene GFI1.
24023884 2013 GFI1 is repressed by p53 and inhibits DNA damage-induced apoptosis.
24018353 2014 Gfi-1 is the transcriptional repressor of SOCS1 in acute myeloid leukemia cells.
23528269 2013 Growth factor independence 1 (Gfi1) as a regulator of p53 activity and a new therapeutical target for ALL.
More...