Property Summary

NCBI Gene PubMed Count 190
Grant Count 318
R01 Count 259
Funding $20,246,855.76
PubMed Score 467.70
PubTator Score 288.64

Knowledge Summary

Patent (19,893)

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.036
Chronic Lymphocytic Leukemia 1.454 0.000
malignant mesothelioma -4.900 0.000
psoriasis 1.900 0.000
ependymoma -1.200 0.000
glioblastoma -2.000 0.004
group 3 medulloblastoma -2.400 0.000
astrocytoma 1.900 0.005
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -2.800 0.000
adrenocortical carcinoma -1.775 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.003
lung cancer -2.600 0.000
active Crohn's disease 1.028 0.021
active ulcerative colitis 1.474 0.032
pediatric high grade glioma -1.500 0.003
aldosterone-producing adenoma -1.444 0.043
lung carcinoma 1.200 0.000
spina bifida -1.059 0.040
Pick disease 1.100 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q99683 A6NIA0 B4DGB2 Q5THN3 Q99461
Symbols ASK1
MEKK5
MAPKKK5

Gene

PANTHER Protein Class (3)

PDB

2CLQ   3VW6   4BF2   4BHN   4BIB   4BIC   4BID   4BIE  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (162)

PMID Text
27045525 ASK1 signalling regulates brown and beige adipocyte function.
26773495 Together, we suggest that 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to potently inhibit human HCC cells.
26707143 curcumin and ABT-737 on HCC cells was investigated for the first time, to the best of our knowledge. It was found that curcumin markedly enhanced the antitumor effects of ABT-737 on HepG2 cells and activate ROS-ASK1-c-Jun N-terminal kinase pathway . .
26694167 results suggest that baicalein-mediated ASK1/JNK activation regulates the mitochondria-dependent apoptosis pathway through the up-regulation of TAp63 and down-regulation of NF-kappaB and CD74/CD44 in B-cell malignancies
26661061 The present findings thus support our notion that ROR1 sustains lung adenocarcinoma survival, at least in part, through direct physical interaction with ASK1
26243192 Data show that the MAPKKK6 ASK2, a modulator of MAPKKK5 ASK1 signaling, was essential for ASK1-dependent apoptosis, but not for inducing interferon-beta (IFNB) expression.
26191261 The expression of ASK1 is correlated with the level of claudin-6 in cervical carcinoma cells and tissues.
26165383 These results implicate the TNF/TRAF2/ASK1/p38 kinase pathway in modulating risk of pulmonary complications.
26134265 TNF-alpha-induced ASK1-p38/JNK pathway is an important mediator of cytokine synthesis and enhanced expression of adhesion molecules in rheumatoid arthritis and is inhibited by thymoquinone.
26095851 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
More...

AA Sequence

MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAA      1 - 70
TSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREACETVGATLETLHFGKLDFGET     71 - 140
TVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDSLQSLKEIICQKNTMCTGNY    141 - 210
TFVPYMITPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDI    211 - 280
RKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHH    281 - 350
VKFHYAFALNRRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFK    351 - 420
KAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLAND    421 - 490
HMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVDFWMDFLVEATKTDVTVVRFP    491 - 560
VLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHEWNFSASSVRGVSISKFEERCCFLYVLHNS    561 - 630
DDFQIYFCTELHCKKFFEMVNTITEEKGRSTEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDL    631 - 700
SNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKW    701 - 770
GPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFT    771 - 840
GTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAE    841 - 910
AKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDTSSSS    911 - 980
EYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSER    981 - 1050
RATLHRILTEDQDKIVRNLMESLAQGAEEPKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFD   1051 - 1120
SHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQE   1121 - 1190
DLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELV   1191 - 1260
RKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRF   1261 - 1330
LAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT                             1331 - 1374
//

Text Mined References (211)

PMID Year Title
27045525 2016 ASK1 signalling regulates brown and beige adipocyte function.
26773495 2016 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to inhibit hepatocellular carcinoma cells.
26707143 2016 Curcumin enhances the antitumor effect of ABT-737 via activation of the ROS-ASK1-JNK pathway in hepatocellular carcinoma cells.
26694167 2016 ASK1/JNK-mediated TAp63 activation controls the cell survival signal of baicalein-treated EBV-transformed B cells.
26661061 2016 Receptor tyrosine kinase-like orphan receptor 1, a target of NKX2-1/TTF-1 lineage-survival oncogene, inhibits apoptosis signal-regulating kinase 1-mediated pro-apoptotic signaling in lung adenocarcinoma.
26243192 2015 The ASK family kinases differentially mediate induction of type I interferon and apoptosis during the antiviral response.
26191261 2015 Expression of apoptosis signal-regulating kinase 1 is associated with tight junction protein claudin-6 in cervical carcinoma.
26165383 2015 Genetic variation in the TNF/TRAF2/ASK1/p38 kinase signaling pathway as markers for postoperative pulmonary complications in lung cancer patients.
26134265 2015 Thymoquinone inhibits TNF-?-induced inflammation and cell adhesion in rheumatoid arthritis synovial fibroblasts by ASK1 regulation.
26095851 2015 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
More...