Property Summary

Ligand Count 41
NCBI Gene PubMed Count 203
PubMed Score 525.42
PubTator Score 288.64

Knowledge Summary

Patent (19,893)

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.028 2.1e-02
active ulcerative colitis 1.321 3.2e-02
adrenocortical carcinoma -1.775 7.0e-05
aldosterone-producing adenoma -1.444 4.3e-02
astrocytoma 1.900 5.2e-03
atypical teratoid / rhabdoid tumor -3.100 3.5e-08
Chronic Lymphocytic Leukemia 1.001 5.1e-04
ependymoma -1.200 5.0e-06
glioblastoma -1.200 2.7e-03
group 3 medulloblastoma -2.300 6.8e-07
intraductal papillary-mucinous neoplasm ... -1.200 2.8e-03
lung cancer -2.600 6.7e-05
lung carcinoma 1.200 1.2e-15
malignant mesothelioma -4.900 5.2e-09
medulloblastoma, large-cell -3.100 2.2e-04
ovarian cancer -1.100 1.2e-05
pediatric high grade glioma -1.500 2.6e-03
Pick disease 1.100 6.5e-05
primitive neuroectodermal tumor -2.400 1.0e-03
psoriasis 1.900 1.0e-04
Rheumatoid arthritis 1.300 3.6e-02
spina bifida -1.059 4.0e-02

Protein-protein Interaction (1)

Gene RIF (162)

AA Sequence

MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAA      1 - 70
TSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREACETVGATLETLHFGKLDFGET     71 - 140
TVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDSLQSLKEIICQKNTMCTGNY    141 - 210
TFVPYMITPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDI    211 - 280
RKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHH    281 - 350
VKFHYAFALNRRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFK    351 - 420
KAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLAND    421 - 490
HMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVDFWMDFLVEATKTDVTVVRFP    491 - 560
VLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHEWNFSASSVRGVSISKFEERCCFLYVLHNS    561 - 630
DDFQIYFCTELHCKKFFEMVNTITEEKGRSTEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDL    631 - 700
SNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKW    701 - 770
GPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFT    771 - 840
GTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAE    841 - 910
AKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDTSSSS    911 - 980
EYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSER    981 - 1050
RATLHRILTEDQDKIVRNLMESLAQGAEEPKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFD   1051 - 1120
SHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQE   1121 - 1190
DLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELV   1191 - 1260
RKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRF   1261 - 1330
LAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT                             1331 - 1374
//

Text Mined References (224)

PMID Year Title