Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.88
PubTator Score 3.82

Knowledge Summary

Patent (5,193)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.100 0.001
ependymoma -3.600 0.000
oligodendroglioma -3.000 0.002
permanent atrial fibrillation -1.100 0.000
glioblastoma -4.200 0.000
medulloblastoma -4.700 0.000
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -4.600 0.000
primitive neuroectodermal tumor -4.200 0.000
lung cancer 1.100 0.023
adult high grade glioma -3.200 0.004
pilocytic astrocytoma -3.600 0.000

Synonym

Accession Q99680 O14554
Symbols

Gene

PANTHER Protein Class (2)

  TechDev Info (3)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available
Steve Finkbeiner Neuron specific phenotypes being screened

Gene RIF (3)

PMID Text
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20112360 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18539757 Demonstrate GRR22 expression in human heart.

AA Sequence

MCFSPILEINMQSESNITVRDDIDDINTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNLTVLVLYCMKS      1 - 70
NLINSVSNIITMNLHVLDVIICVGCIPLTIVILLLSLESNTALICCFHEACVSFASVSTAINVFAITLDR     71 - 140
YDISVKPANRILTMGRAVMLMISIWIFSFFSFLIPFIEVNFFSLQSGNTWENKTLLCVSTNEYYTELGMY    141 - 210
YHLLVQIPIFFFTVVVMLITYTKILQALNIRIGTRFSTGQKKKARKKKTISLTTQHEATDMSQSSGGRNV    211 - 280
VFGVRTSVSVIIALRRAVKRHRERRERQKRVFRMSLLIISTFLLCWTPISVLNTTILCLGPSDLLVKLRL    281 - 350
CFLVMAYGTTIFHPLLYAFTRQKFQKVLKSKMKKRVVSIVEADPLPNNAVIHNSWIDPKRNKKITFEDSE    351 - 420
IREKCLVPQVVTD                                                             421 - 433
//

Text Mined References (10)

PMID Year Title
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20112360 2010 A genome-wide association study identifies an osteoarthritis susceptibility locus on chromosome 7q22.
18539757 2008 Myocardial expression, signaling, and function of GPR22: a protective role for an orphan G protein-coupled receptor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15955843 2005 Effects of RNA degradation on gene expression analysis of human postmortem tissues.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9073069 1997 Cloning and chromosomal mapping of four putative novel human G-protein-coupled receptor genes.