Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.92
PubTator Score 3.82

Knowledge Summary

Patent (5,193)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.000 9.3e-04
astrocytic glioma -3.100 9.6e-04
Astrocytoma, Pilocytic -3.500 2.6e-07
atypical teratoid / rhabdoid tumor -4.400 2.7e-14
ependymoma -3.300 1.2e-03
glioblastoma -3.100 2.6e-08
group 3 medulloblastoma -3.600 2.2e-03
lung cancer 1.100 2.3e-02
medulloblastoma, large-cell -4.200 1.7e-06
oligodendroglioma -3.000 1.7e-03
permanent atrial fibrillation -1.100 3.3e-06
primitive neuroectodermal tumor -3.600 8.3e-05

Gene RIF (3)

AA Sequence

MCFSPILEINMQSESNITVRDDIDDINTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNLTVLVLYCMKS      1 - 70
NLINSVSNIITMNLHVLDVIICVGCIPLTIVILLLSLESNTALICCFHEACVSFASVSTAINVFAITLDR     71 - 140
YDISVKPANRILTMGRAVMLMISIWIFSFFSFLIPFIEVNFFSLQSGNTWENKTLLCVSTNEYYTELGMY    141 - 210
YHLLVQIPIFFFTVVVMLITYTKILQALNIRIGTRFSTGQKKKARKKKTISLTTQHEATDMSQSSGGRNV    211 - 280
VFGVRTSVSVIIALRRAVKRHRERRERQKRVFRMSLLIISTFLLCWTPISVLNTTILCLGPSDLLVKLRL    281 - 350
CFLVMAYGTTIFHPLLYAFTRQKFQKVLKSKMKKRVVSIVEADPLPNNAVIHNSWIDPKRNKKITFEDSE    351 - 420
IREKCLVPQVVTD                                                             421 - 433
//

Text Mined References (10)

PMID Year Title