Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.92
PubTator Score 2.47

Knowledge Summary

Patent (2,018)

Synonym

Accession Q99679 B2R8W9 Q6NXU2
Symbols

Gene

PANTHER Protein Class (2)

  TechDev Info (2)

Bryan Roth functional assay
Steve Finkbeiner Neuron specific phenotypes being screened

AA Sequence

MNSTLDGNQSSHPFCLLAFGYLETVNFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLNHHTTSYFIQT      1 - 70
MAYADLFVGVSCVVPSLSLLHHPLPVEESLTCQIFGFVVSVLKSVSMASLACISIDRYIAITKPLTYNTL     71 - 140
VTPWRLRLCIFLIWLYSTLVFLPSFFHWGKPGYHGDVFQWCAESWHTDSYFTLFIVMMLYAPAALIVCFT    141 - 210
YFNIFRICQQHTKDISERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYILWLPYIIYFLLESSTGH    211 - 280
SNRFASFLTTWLAISNSFCNCVIYSLSNSVFQRGLKRLSGAMCTSCASQTTANDPYTVRSKGPLNGCHI     281 - 349
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15090189 2003 Identification of signal transduction pathways used by orphan g protein-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9073069 1997 Cloning and chromosomal mapping of four putative novel human G-protein-coupled receptor genes.