Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.50
PubTator Score 2.10

Knowledge Summary

Patent (1,463)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cognitive disorder 50 0.0 1.2

Expression

Gene RIF (1)

AA Sequence

MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVL      1 - 70
NGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILF     71 - 140
LTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLL    141 - 210
VISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYH    211 - 280
VAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQ    281 - 350
ALANGPEA                                                                  351 - 358
//

Text Mined References (6)

PMID Year Title