Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.50
PubTator Score 2.10

Knowledge Summary

Patent (1,463)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cognitive disorder 44 1.0

Expression

Synonym

Accession Q99678 Q17R96
Symbols

Gene

PANTHER Protein Class (2)

  TechDev Info (2)

Bryan Roth functional assay
Steve Finkbeiner Neuron specific phenotypes being screened

Gene RIF (1)

PMID Text
18347022 GPR20 constitutively activates G(i) proteins without ligand stimulation

AA Sequence

MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVL      1 - 70
NGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILF     71 - 140
LTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLL    141 - 210
VISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYH    211 - 280
VAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQ    281 - 350
ALANGPEA                                                                  351 - 358
//

Text Mined References (6)

PMID Year Title
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
18347022 2008 Characterization of an orphan G protein-coupled receptor, GPR20, that constitutively activates Gi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9073069 1997 Cloning and chromosomal mapping of four putative novel human G-protein-coupled receptor genes.